Mouse Anti-Cattle DLD Antibody (MO-AB-11477R)


Cat: MO-AB-11477R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO11477R
SpecificityThis antibody binds to Cattle DLD.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the class-I pyridine nucleotide-disulfide oxidoreductase family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. In homodimeric form, the encoded protein functions as a dehydrogenase and is found in several multi-enzyme complexes that regulate energy metabolism. However, as a monomer, this protein can function as a protease. Mutations in this gene have been identified in patients with E3-deficient maple syrup urine disease and lipoamide dehydrogenase deficiency. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Cattle DLD Antibody is a mouse antibody against DLD. It can be used for DLD detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDihydrolipoyl dehydrogenase; EC 1.8.1.4; DLD
UniProt IDF1N206
Protein RefseqThe length of the protein is 509 amino acids long.
The sequence is show below: MQSWSRVYCSLVKRGHFSRISHGLQGVSVVPLRTYADQPIDADVTVIGSGPGGYVAAIKAAQLGFKTVCVEKNETLGGTCLNVGCIPSKALLNNSHFYHLAHGKDFASRGIEMSEVRLNLEKMMEQKSNAVKALTGGIAHLFKQNKVVHVNGYGKITGKNQVTATKADGSTQVIDTKNILIATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKLVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGVGIDM.
For Research Use Only | Not For Clinical Use.
Online Inquiry