Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September, the 10th Annual Immuno-Oncology Summit in October, and the Antibody Engineering & Therapeutics (US) 2022 in December for expert consultation on your drug discovery projects. Shoot an email to arrange an in-person meeting!

Mouse Anti-Cattle DPP4 Antibody (MO-AB-11637R)


Cat: MO-AB-11637R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO11637R
SpecificityThis antibody binds to Cattle DPP4.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle DPP4 (clone MO11637R) Antibody (MO-AB-11637R) is a mouse antibody against DPP4. It can be used for DPP4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDipeptidyl peptidase IV, Fragment; DPP4
UniProt IDQ9BDD9
Protein RefseqThe length of the protein is 37 amino acids long.
The sequence is show below: TVMSRAENFKQVEYLLIHGTADDNVHFQQSAQISKAL.

See other products for " DPP4 "

CBMOAB-41149FYAMouse Anti-Rhesus DPP4 Antibody (CBMOAB-41149FYA)
MO-AB-37145WMouse Anti-Goat DPP4 Antibody (MO-AB-37145W)
CBMOAB-00064FYAMouse Anti-Cattle DPP4 Antibody (CBMOAB-00064FYA)
MO-AB-43089WMouse Anti-Hamsters DPP4 Antibody (MO-AB-43089W)
MO-AB-14987YMouse Anti-Sheep DPP4 Antibody (MO-AB-14987Y)
MO-AB-34691WMouse Anti-Ferret DPP4 Antibody (MO-AB-34691W)
MO-AB-03092HMouse Anti-Frog dpp4 Antibody (MO-AB-03092H)
CBMOAB-00066FYAMouse Anti-Cattle DPP4 Antibody (CBMOAB-00066FYA)
MO-AB-19559WMouse Anti-Chimpanzee DPP4 Antibody (MO-AB-19559W)
MO-AB-54471WMouse Anti-Marmoset DPP4 Antibody (MO-AB-54471W)
For Research Use Only | Not For Clinical Use.

Online Inquiry