Mouse Anti-Cattle DPP4 Antibody (MO-AB-11637R)


Cat: MO-AB-11637R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO11637R
SpecificityThis antibody binds to Cattle DPP4.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle DPP4 (clone MO11637R) Antibody (MO-AB-11637R) is a mouse antibody against DPP4. It can be used for DPP4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDipeptidyl peptidase IV, Fragment; DPP4
UniProt IDQ9BDD9
Protein RefseqThe length of the protein is 37 amino acids long.
The sequence is show below: TVMSRAENFKQVEYLLIHGTADDNVHFQQSAQISKAL.

See other products for " DPP4 "

MO-AB-08654WMouse Anti-Cat DPP4 Antibody (MO-AB-08654W)
CBMOAB-41149FYAMouse Anti-Rhesus DPP4 Antibody (CBMOAB-41149FYA)
MO-AB-34691WMouse Anti-Ferret DPP4 Antibody (MO-AB-34691W)
MO-AB-11635RMouse Anti-Cattle DPP4 Antibody (MO-AB-11635R)
MO-AB-19559WMouse Anti-Chimpanzee DPP4 Antibody (MO-AB-19559W)
MO-AB-07731WMouse Anti-Cat DPP4 Antibody (MO-AB-07731W)
MO-AB-03091HMouse Anti-Frog dpp4 Antibody (MO-AB-03091H)
CBMOAB-00067FYAMouse Anti-Cattle DPP4 Antibody (CBMOAB-00067FYA)
MO-AB-14987YMouse Anti-Sheep DPP4 Antibody (MO-AB-14987Y)
MO-AB-11636RMouse Anti-Cattle DPP4 Antibody (MO-AB-11636R)
For Research Use Only | Not For Clinical Use.

Online Inquiry