Mouse Anti-Cattle EPS8 Antibody (MO-AB-12092R)


Cat: MO-AB-12092R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO12092R
SpecificityThis antibody binds to Cattle EPS8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the EPS8 family. This protein contains one PH domain and one SH3 domain. It functions as part of the EGFR pathway, though its exact role has not been determined. Highly similar proteins in other organisms are involved in the transduction of signals from Ras to Rac and growth factor-mediated actin remodeling. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.
Product OverviewMouse Anti-Cattle EPS8 Antibody is a mouse antibody against EPS8. It can be used for EPS8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEpidermal growth factor receptor pathway substrate 8; EPS8
UniProt IDQ29RL8
Protein RefseqThe length of the protein is 345 amino acids long.
The sequence is show below: MNGHISSHPSGFGMNPSQMNGYGSSATLSMDRDHSSRTSAKALYGPDGSYFFRSSSKQKKKEQRKNYARDSVSSVSDISQYRVEHLTTFVLDRKDAMITVDDGIRKLKLLDAKGKVWTQDMILQVDEKAVSLIDLESKNELENFPLNTIQHCQAVMHSCSYDSILALVCKEPTQSKPDLHLFQCDEIKANLISEDVESAISDSKGGKQKRRLDVLRMISKADPGIPPPPKAPAPVPPGTVTQVDVRSRVAAWSAL.
For Research Use Only | Not For Clinical Use.
Online Inquiry