Mouse Anti-Cattle FOXO1 Antibody (MO-AB-12680R)


Cat: MO-AB-12680R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO12680R
SpecificityThis antibody binds to Cattle FOXO1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionForkhead box protein O1 (FOXO1), also known as forkhead in rhabdomyosarcoma (FKHR), is a protein encoded by the FOXO1 gene in humans. FOXO1 is a transcription factor that plays an important role in regulating gluconeogenesis and glycogenolysis through insulin signaling, and is also the key to determining the participation of preadipocytes in fat formation. It is mainly regulated by phosphorylation of multiple residues. Its transcriptional activity depends on its phosphorylation status.
Product OverviewMouse Anti-Cattle FOXO1 Antibody is a mouse antibody against FOXO1. It can be used for FOXO1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesForkhead box protein O1; Forkhead box protein O1A; Forkhead in rhabdomyosarcoma; FOXO1; FOXO1A
UniProt IDE1BPQ1
Protein RefseqThe length of the protein is 624 amino acids long.
The sequence is show below: MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGGAAANPDGAAGLPSASAAAVNADFMSNLSLLEESGDFQQAPGSVAAAAPLSQHPPVPPAAAAAAAGGQLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRGRAAKKKASLQSGQEGAG.
For Research Use Only | Not For Clinical Use.
Online Inquiry