Mouse Anti-Cattle GPX4 Antibody (MO-AB-13333R)


Cat: MO-AB-13333R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO13333R
SpecificityThis antibody binds to Cattle GPX4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Mitochondrion; Cytosol; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of hydrogen peroxide, organic hydroperoxides and lipid hydroperoxides, and thereby protect cells against oxidative damage. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme has a high preference for lipid hydroperoxides and protects cells against membrane lipid peroxidation and cell death. It is also required for normal sperm development; thus, it has been identified as a ''moonlighting'' protein because of its ability to serve dual functions as a peroxidase, as well as a structural protein in mature spermatozoa. Mutations in this gene are associated with Sedaghatian type of spondylometaphyseal dysplasia (SMDS). This isozyme is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3'' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Transcript variants resulting from alternative splicing or use of alternate promoters have been described to encode isoforms with different subcellular localization. .
Product OverviewMouse Anti-Cattle GPX4 Antibody is a mouse antibody against GPX4. It can be used for GPX4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPhospholipid hydroperoxide glutathione peroxidase, mitochondrial; PHGPx; EC 1.11.1.12; Glutathione peroxidase 4; GPx-4; GSHPx-4; GPX4
UniProt IDQ9N2J2
Protein RefseqThe length of the protein is 197 amino acids long.
The sequence is show below: MSFSRLYRLLKPALLCGALAAPGLASTMCASRDDWRCARSMHEFSAKDIDGRMVNLDKYRGHVCIVTNVASQUGKTDVNYTQLVDLHARYAECGLRILAFPCNQFGRQEPGSNAEIKEFAAGYNVKFDLFSKICVNGDDAHPLWKWMKVQPKGRGMLGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPCYL.
See other products for " GPX4 "
CBMOAB-00314FYARabbit Anti-Mouse GPX4 Antibody (CBMOAB-00314FYA)
MO-AB-26106HMouse Anti-Rat Gpx4 Antibody (MO-AB-26106H)
MO-AB-04046HMouse Anti-Frog gpx4 Antibody (MO-AB-04046H)
CBMOAB-04658HCBMouse Anti-C. elegans GPX4 Antibody (CBMOAB-04658HCB)
CBMOAB-44072FYAMouse Anti-Rhesus GPX4 Antibody (CBMOAB-44072FYA)
MO-AB-07695WMouse Anti-Cat GPX4 Antibody (MO-AB-07695W)
CBMOAB-60124FYCMouse Anti-Rhesus GPX4 Antibody (CBMOAB-60124FYC)
CBMOAB-34191FYCMouse Anti-Arabidopsis GPX4 Antibody (CBMOAB-34191FYC)
MO-AB-37382WMouse Anti-Goat GPx4 Antibody (MO-AB-37382W)
MO-AB-02216YMouse Anti-Chicken GPX4 Antibody (MO-AB-02216Y)
For Research Use Only | Not For Clinical Use.
Online Inquiry