Mouse Anti-Cattle H2B Antibody (MO-AB-13487R)


Cat: MO-AB-13487R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO13487R
SpecificityThis antibody binds to Cattle H2B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionHistone H2B is one of the core components of nucleosomes. The nucleosome is the smallest subunit of chromatin and consists of 147 DNA base pairs wrapped around the core histone octamer (histone H2A, histone H2B, histone H3, and histone H4). Histone H1 is a linker histone that exists at the interface between the nucleosome core and the DNA entry/exit point; it is responsible for building higher-order chromatin structures. Chromatin undergoes a variety of chemical modifications, including post-translational modifications of histones and methylation of cytosine residues in DNA. The reported histone modifications include acetylation, methylation, phosphorylation, ubiquitination, glycosylation, ADP-ribosylation, carbonylation and SUMOylation; they play a major role in regulating gene expression.
Product OverviewMouse Anti-Cattle H2B Antibody is a mouse antibody against H2B. It can be used for H2B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHistone H2B; H2B
UniProt IDQ32S29
Protein RefseqThe length of the protein is 126 amino acids long.
The sequence is show below: MPEPAKKVPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKPSTITPREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK.
For Research Use Only | Not For Clinical Use.
Online Inquiry