Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September, the 10th Annual Immuno-Oncology Summit in October, and the Antibody Engineering & Therapeutics (US) 2022 in December for expert consultation on your drug discovery projects. Shoot an email to arrange an in-person meeting!

Mouse Anti-Cattle ICAM3 Antibody (MO-AB-13928R)


Cat: MO-AB-13928R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO13928R
SpecificityThis antibody binds to Cattle ICAM3.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle ICAM3 (clone MO13928R) Antibody (MO-AB-13928R) is a mouse antibody against ICAM3. It can be used for ICAM3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesIntercellular adhesion molecule 3; ICAM3
UniProt IDF1MQF0
Protein RefseqThe length of the protein is 544 amino acids long.
The sequence is show below: MMPSGPPPRVYWTSLIFLLLACCLLPTGAQGQTYQVRVEPKDPVVPFGEPLVVNCTLDCPGPGLISLETALSKEPHSRGLGWAAFRLTNVTGDMEILCSGICNKSQVVGFSNITVFGFPKRVELAPLPLWQPVGEELNLSCLVSGGAPRAHLSVVLLRGEEELGQQPLGKEEPAKVTFMVQPRREDHGTNFSCRSELDLRSQGLELFQNTSAPRKLQTYAMPKTAPRLVFPRFWEMETSWPVNCSLDGLFPASEA.

See other products for " ICAM3 "

MO-AB-13929RMouse Anti-Cattle ICAM3 Antibody (MO-AB-13929R)
MO-AB-14085WMouse Anti-Chimpanzee ICAM3 Antibody (MO-AB-14085W)
CBMOAB-45008FYAMouse Anti-Rhesus ICAM3 Antibody (CBMOAB-45008FYA)
CBMOAB-45007FYAMouse Anti-Rhesus ICAM3 Antibody (CBMOAB-45007FYA)
CBMOAB-45006FYAMouse Anti-Rhesus ICAM3 Antibody (CBMOAB-45006FYA)
CBMOAB-45005FYAMouse Anti-Rhesus ICAM3 Antibody (CBMOAB-45005FYA)
CBMOAB-00039FYAMouse Anti-Cattle ICAM3 Antibody (CBMOAB-00039FYA)
CBMOAB-45009FYAMouse Anti-Rhesus ICAM3 Antibody (CBMOAB-45009FYA)
MO-AB-26450RMouse Anti-Pig ICAM3 Antibody (MO-AB-26450R)
For Research Use Only | Not For Clinical Use.

Online Inquiry