Mouse Anti-Cattle IDE Antibody (MO-AB-13937R)


Cat: MO-AB-13937R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO13937R
SpecificityThis antibody binds to Cattle IDE.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPeroxisome; Plasma membrane; Extracellular region or secreted; Cytosol; Mitochondrion; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a zinc metallopeptidase that degrades intracellular insulin, and thereby terminates insulins activity, as well as participating in intercellular peptide signalling by degrading diverse peptides such as glucagon, amylin, bradykinin, and kallidin. The preferential affinity of this enzyme for insulin results in insulin-mediated inhibition of the degradation of other peptides such as beta-amyloid. Deficiencies in this protein''s function are associated with Alzheimer''s disease and type 2 diabetes mellitus but mutations in this gene have not been shown to be causitive for these diseases. This protein localizes primarily to the cytoplasm but in some cell types localizes to the extracellular space, cell membrane, peroxisome, and mitochondrion. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional transcript variants have been described but have not been experimentally verified.[provided by RefSeq, Sep 2009]
Product OverviewMouse Anti-Cattle IDE Antibody is a mouse antibody against IDE. It can be used for IDE detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInsulin-degrading enzyme; EC 3.4.24.56; Insulin protease; Insulinase; Insulysin; IDE
UniProt IDQ24K02
Protein RefseqThe length of the protein is 1019 amino acids long.
The sequence is show below: MRYRLAWLLHSALPSTFRSVLGARLPPSERLCGFQKKTYSKMNNPAIKRIGHHIIKSHEDKREYRGLELANGIKVLLVSDPTTDKSSAALDVHIGSLSDPPNIAGLSHFCEHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFLCPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRPNQEGIDVRQELLKFHSTYYSSNLMA.
For Research Use Only | Not For Clinical Use.
Online Inquiry