Mouse Anti-Cattle ITGAM Antibody (MO-AB-14327R)
Cat: MO-AB-14327R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Cattle (Bos taurus) |
| Clone | MO14327R |
| Specificity | This antibody binds to Cattle ITGAM. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Plasma membrane; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Integrin αM (ITGAM) is a protein subunit that can form heterodimeric integrin α-Mbeta-2 (αMβ2) molecules, also known as macrophage-1 antigen (Mac-1) or complement receptor 3 (CR3). ITGAM, also known as CR3A, is a cluster of differentiation molecules 11B (CD11B). The second chain of αMβ2 is a common integrin β2 subunit called CD18, so integrin αMβ2 belongs to the β2 subfamily (or leukocyte) integrin. αMβ2 is expressed on the surface of many white blood cells involved in the innate immune system, including monocytes, granulocytes, macrophages and natural killer cells. It mediates inflammation by regulating the adhesion and migration of leukocytes, and is related to various immune processes such as phagocytosis, cell-mediated cytotoxicity, chemotaxis and cell activation. It participates in the complement system because it has the ability to bind the inactivated complement component 3b (iC3b). The ITGAMα subunit of integrin αMβ2 is directly involved in causing cell adhesion and spreading, but if β2 (CD18) subunit is not present, it cannot mediate cell migration. |
| Product Overview | Mouse Anti-Cattle ITGAM Antibody is a mouse antibody against ITGAM. It can be used for ITGAM detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Integrin alpha M; ITGAM |
| UniProt ID | Q24LN2 |
| Protein Refseq | The length of the protein is 1152 amino acids long. The sequence is show below: MALRVLLLTALALCHGFNLDTEKAVIFQNNARGFGQSVVQIQGSRLVVGAPQEVKAANQTGGLYHCDYSTGRCEAIPLQVPPEAVNMSLGLSLAFAANPFRLLACGPTVHQICKENTYANGLCFSFGSNLLQQPRRIPRALRGCPEQDSDIAFLIDGSGSIDPVDFERMKRFVSTVMSQFQKSKTLFSLMQYSDDFQTHFTFNDFKRNPVPEFLVGPIRQLFGRTHTATGIRKVVRELFHSSSGARNHAIKIMIV. |
See other products for " ITGAM "
| CBMOAB-00016FYA | Mouse Anti-Cattle ITGAM Antibody (CBMOAB-00016FYA) |
| MO-AB-26742R | Mouse Anti-Pig Itgam Antibody (MO-AB-26742R) |
| MO-AB-03868W | Mouse Anti-Rhesus ITGAM Antibody (MO-AB-03868W) |
| CBMOAB-81258FYA | Mouse Anti-Zebrafish itgam Antibody (CBMOAB-81258FYA) |
| CBMOAB-00173FYA | Mouse Anti-Rabbit ITGAM Antibody (CBMOAB-00173FYA) |
| MO-AB-41893W | Mouse Anti-Guinea pig ITGAM Antibody (MO-AB-41893W) |
| MOFY-0522-FY38 | Mouse Anti-ITGAM Antibody (MOFY-0522-FY38) |
| MOFY-0522-FY47 | Rat Anti-ITGAM Antibody (MOFY-0522-FY47) |
| MO-DKB-00397W | Rabbit Anti-ITGAM Antibody (MO-DKB-00397W) |
| CBMOAB-00017FYA | Mouse Anti-Cattle ITGAM Antibody (CBMOAB-00017FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry