Mouse Anti-Cattle ITGB2 Antibody (MO-AB-14334R)


Cat: MO-AB-14334R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO14334R
SpecificityThis antibody binds to Cattle ITGB2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an integrin beta chain, which combines with multiple different alpha chains to form different integrin heterodimers. Integrins are integral cell-surface proteins that participate in cell adhesion as well as cell-surface mediated signalling. The encoded protein plays an important role in immune response and defects in this gene cause leukocyte adhesion deficiency. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Cattle ITGB2 Antibody is a mouse antibody against ITGB2. It can be used for ITGB2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesIntegrin beta-2; Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta; Complement receptor C3 subunit beta; CD antigen CD18; ITGB2; CD18
UniProt IDP32592
Protein RefseqThe length of the protein is 769 amino acids long.
The sequence is show below: MLRQRPQLLLLAGLLALQSVLSQECTNYKVSTCRDCIESGPGCAWCQKLNFTGQGEPDSIRCDTRAELLSKGCPADDIMEPKSLAETRDSQAGSRKQLSPQEVTLYLRPGQAVAFNVTFRRAKGYPIDLYYLMDLSYSMVDDLVNVKKLGGDLLRALNGITESGRIGFGSFVDKTVLPFVNTHPEKLRNPCPNKEKECQPPFAFRHVLKLTDNSKQFETEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRNV.
For Research Use Only | Not For Clinical Use.
Online Inquiry