Mouse Anti-Cattle MAP1LC3B Antibody (MO-AB-15301R)


Cat: MO-AB-15301R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO15301R
SpecificityThis antibody binds to Cattle MAP1LC3B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Lysosome; Cytosol; Cytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionIt is observed enhanced LC3B and other autophagy-related molecules by inducing oxidative stress in OC cells using ROS-generating pro-oxidant molecules. Enhanced LC3B fails to induce autophagosome formation, possibly due to reduced ULK1 complexes. ROS-induced enhanced LC3B also increased apoptosis. Furthermore, LC3B inhibits cell adhesion molecules/mesenchymal markers, leading to anoikis. Furthermore, in vitro studies showed that ROS-dependent enhanced LC3B reduced tumor growth. Similar effects were observed with primary cells from patients. Here, we demonstrate the unique role of LC3B in in vitro/in vivo/ex vivo induction of anoikis.
Product OverviewMouse Anti-Cattle MAP1LC3B Antibody is a mouse antibody against MAP1LC3B. It can be used for MAP1LC3B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMicrotubule-associated proteins 1A/1B light chain 3B; Autophagy-related protein LC3 B; Autophagy-related ubiquitin-like modifier LC3 B; MAP1 light chain 3-like protein 2; MAP1A/MAP1B light chain 3 B; MAP1A/MAP1B LC3 B; Microtubule-associated protein 1 lig癷?癸MAP1LC3B; MAP1ALC3 MAP1LC3
UniProt IDO41515
Protein RefseqThe length of the protein is 125 amino acids long.
The sequence is show below: MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPICEVYESEKDEDGFLYMVYASQETFGMKLSV.
For Research Use Only | Not For Clinical Use.
Online Inquiry