Mouse Anti-Cattle MCM3 Antibody (MO-AB-15456R)


Cat: MO-AB-15456R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO15456R
SpecificityThis antibody binds to Cattle MCM3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus; Cytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5 / CDC46. This protein also interacts with and is acetylated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. Two transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Cattle MCM3 Antibody is a mouse antibody against MCM3. It can be used for MCM3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDNA replication licensing factor MCM3; EC 3.6.4.12; MCM3
UniProt IDA4FUD9
Protein RefseqThe length of the protein is 808 amino acids long.
The sequence is show below: MAGTVVLDDVELREAQRDYLDFLDDEEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEKRANRLLSNAFEELVAFQRALKDFVASIDATYAKQYEEFYIGLEGSFGSKHVSPRTLTSCFLSCVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERRYSDLTSLVAFPSSSVYPTKDEENNPLETEYGLSVYKDHQIITIQEMPEKAPAGQLPRSVDVILDDDLVDRVKPGDRVQVVGTYRCLPGKKGGYTSGT.
For Research Use Only | Not For Clinical Use.
Online Inquiry