Mouse Anti-Cattle MGC128049 (clone MO15636R) Antibody (MO-AB-15636R)


Cat: MO-AB-15636R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO15636R
SpecificityThis antibody binds to Cattle MGC128049.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle MGC128049 (clone MO15636R) Antibody (MO-AB-15636R) is a mouse antibody against MGC128049. It can be used for MGC128049 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative uncharacterized protein MGC128049; MGC128049
UniProt IDQ3SZT0
Protein RefseqThe length of the protein is 117 amino acids long.
The sequence is show below: MSERLRPRKRRRNGSEEDHHLPPQTKRSSRNPVFHDSWDTESSSSDSGGSSSSSISSPDRASGPESSLHHLAAGPGPHTPQPAPEPSALCQGPYFHINQTLKEAHFHSLQHRGRPPS.
For Research Use Only | Not For Clinical Use.

Online Inquiry