Mouse Anti-Cattle MMP2 Antibody (MO-AB-15872R)
Cat: MO-AB-15872R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Cattle (Bos taurus) |
| Clone | MO15872R |
| Specificity | This antibody binds to Cattle MMP2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted; Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene is a member of the matrix metalloproteinase (MMP) gene family, that are zinc-dependent enzymes capable of cleaving components of the extracellular matrix and molecules involved in signal transduction. The protein encoded by this gene is a gelatinase A, type IV collagenase, that contains three fibronectin type II repeats in its catalytic site that allow binding of denatured type IV and V collagen and elastin. Unlike most MMP family members, activation of this protein can occur on the cell membrane. This enzyme can be activated extracellularly by proteases, or, intracellulary by its S-glutathiolation with no requirement for proteolytical removal of the pro-domain. This protein is thought to be involved in multiple pathways including roles in the nervous system, endometrial menstrual breakdown, regulation of vascularization, and metastasis. Mutations in this gene have been associated with Winchester syndrome and Nodulosis-Arthropathy-Osteolysis (NAO) syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Product Overview | Mouse Anti-Cattle MMP2 Antibody is a mouse antibody against MMP2. It can be used for MMP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | 72 kDa type IV collagenase; EC 3.4.24.24; 72 kDa gelatinase; Matrix metalloproteinase-2; MMP-2; [Cleaved into: PEX]; MMP2 |
| UniProt ID | Q9GLE5 |
| Protein Refseq | The length of the protein is 661 amino acids long. The sequence is show below: MTEARVSRGALAALLRALCALGCLLGRAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGELDQSTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPQTVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGPGVGGDSHFDDDELRTLGEGQVVRVKYGNADGEYCKFPFRFNGKEYTSCTDTGRSD. |
See other products for " MMP2 "
| MO-AB-31896H | Mouse Anti-Soybean MMP2 Antibody (MO-AB-31896H) |
| CBMOAB-24411FYA | Mouse Anti-D. melanogaster Mmp2 Antibody (CBMOAB-24411FYA) |
| MO-MMB-0717 | Anti-MMP2 Antibody (Cat MO-MMB-0717), Rabbit IgG |
| CBMOAB-87120FYA | Mouse Anti-Zebrafish mmp2 Antibody (CBMOAB-87120FYA) |
| MO-AB-08843Y | Mouse Anti-Rabbit MMP2 Antibody (MO-AB-08843Y) |
| MO-AB-05230H | Mouse Anti-Frog mmp2 Antibody (MO-AB-05230H) |
| MO-AB-59189W | Mouse Anti-Marmoset MMP2 Antibody (MO-AB-59189W) |
| MO-AB-16174Y | Mouse Anti-Sheep MMP2 Antibody (MO-AB-16174Y) |
| MOFY-1222-FY26 | Rabbit Anti-mmp2 Antibody (MOFY-1222-FY26) |
For Research Use Only | Not For Clinical Use.
Online Inquiry