Mouse Anti-Cattle MSR1 Antibody (MO-AB-16105R)
Cat: MO-AB-16105R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Cattle (Bos taurus) |
Clone | MO16105R |
Specificity | This antibody binds to Cattle MSR1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted; Plasma membrane; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes the class A macrophage scavenger receptors, which include three different types (1, 2, 3) generated by alternative splicing of this gene. These receptors or isoforms are macrophage-specific trimeric integral membrane glycoproteins and have been implicated in many macrophage-associated physiological and pathological processes including atherosclerosis, Alzheimer''s disease, and host defense. The isoforms type 1 and type 2 are functional receptors and are able to mediate the endocytosis of modified low density lipoproteins (LDLs). The isoform type 3 does not internalize modified LDL (acetyl-LDL) despite having the domain shown to mediate this function in the types 1 and 2 isoforms. It has an altered intracellular processing and is trapped within the endoplasmic reticulum, making it unable to perform endocytosis. The isoform type 3 can inhibit the function of isoforms type 1 and type 2 when co-expressed, indicating a dominant negative effect and suggesting a mechanism for regulation of scavenger receptor activity in macrophages. |
Product Overview | Mouse Anti-Cattle MSR1 Antibody is a mouse antibody against MSR1. It can be used for MSR1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Macrophage scavenger receptor types I and II; Macrophage acetylated LDL receptor I and II; CD antigen CD204; MSR1 |
UniProt ID | P21758 |
Protein Refseq | The length of the protein is 453 amino acids long. The sequence is show below: MAQWDDFPDQQEDTDSCTESVKFDARSVTALLPPHPKNGPTLQERMKSYKTALITLYLIVFVVLVPIIGIVAAQLLKWETKNCTVGSVNADISPSPEGKGNGSEDEMRFREAVMERMSNMESRIQYLSDNEANLLDAKNFQNFSITTDQRFNDVLFQLNSLLSSIQEHENIIGDISKSLVGLNTTVLDLQFSIETLNGRVQENAFKQQEEMRKLEERIYNASAEIKSLDEKQVYLEQEIKGEMKLLNNITNDLRL. |
See other products for " Msr1 "
CBMOAB-24889FYA | Mouse Anti-D. melanogaster Msr1 Antibody (CBMOAB-24889FYA) |
CBMOAB-02473CR | Mouse Anti-Yeast MSR1 Antibody (CBMOAB-02473CR) |
MO-AB-08866Y | Mouse Anti-Rabbit MSR1 Antibody (MO-AB-08866Y) |
CBMOAB-51824FYA | Mouse Anti-Rhesus MSR1 Antibody (CBMOAB-51824FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry