Mouse Anti-Cattle NEK3 Antibody (MO-AB-16656R)


Cat: MO-AB-16656R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO16656R
SpecificityThis antibody binds to Cattle NEK3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the NimA (never in mitosis A) family of serine / threonine protein kinases. The encoded protein differs from other NimA family members in that it is not cell cycle regulated and is found primarily in the cytoplasm. The kinase is activated by prolactin stimulation, leading to phosphorylation of VAV2 guanine nucleotide exchange factor, paxillin, and activation of the RAC1 GTPase. Multiple transcript variants encoding different isoforms have been found for this gene.
Product OverviewThis product is a mouse antibody against NEK3. It can be used for NEK3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNEK3 protein; NEK3
UniProt IDA4IFF6
Protein RefseqThe length of the protein is 495 amino acids long.
The sequence is show below: MDGYRVLRVIGEGSFGRALLVQQESSNRMFAMKEIRLPKSLSDTRISRKEAVLLAKMKHPNIVAFKESFEAEGHLYIVMEYCDGGDLMQKIKHQKGKLFPEDTILHWFTQMCLGVNHIHKKRVLHRDIKSKNIFLTQDGKVKLGDFGSARLLSSPMAFACTYVGTPYYVPPEIWENMPYNNKSDIWSLGCILYELCTLKHPFQANSWKSLILKICQGSMNPLPSHYSYELQHLIKQMFKKNPSHRPSATTLLSRG.
For Research Use Only | Not For Clinical Use.
Online Inquiry