Mouse Anti-Cattle NMT1 Antibody (MO-AB-16813R)


Cat: MO-AB-16813R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO16813R
SpecificityThis antibody binds to Cattle NMT1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMyristate, a rare 14-carbon saturated fatty acid, is cotranslationally attached by an amide linkage to the N-terminal glycine residue of cellular and viral proteins with diverse functions. N-myristoyltransferase (NMT; EC 2.3.1.97) catalyzes the transfer of myristate from CoA to proteins. N-myristoylation appears to be irreversible and is required for full expression of the biologic activities of several N-myristoylated proteins, including the alpha subunit of the signal-transducing guanine nucleotide-binding protein (G protein) GO (GNAO1; MIM 139311) (Duronio et al., 1992 [PubMed 1570339]).
Product OverviewThis product is a mouse antibody against NMT1. It can be used for NMT1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlycylpeptide N-tetradecanoyltransferase 1; EC 2.3.1.97; Myristoyl-CoA:protein N-myristoyltransferase 1; NMT 1; Type I N-myristoyltransferase; Peptide N-myristoyltransferase 1; NMT1; NMT
UniProt IDP31717
Protein RefseqThe length of the protein is 497 amino acids long.
The sequence is show below: MGDESETAVKPPAPPLPQMMEGNGNGHEHCSDCENEEDNSYNRGGLSPANDTGAKKKKKKQKKKKEKGSETDSAQDQPVKMNSLPAERIQEIQKAIELFSVGQGPAKTMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFTWDALDLGDRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLPQWHCGVRVVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKLR.
See other products for " NMT1 "
MO-AB-08962YMouse Anti-Rabbit NMT1 Antibody (MO-AB-08962Y)
MO-AB-07844WMouse Anti-Cat NMT1 Antibody (MO-AB-07844W)
MO-AB-05673HMouse Anti-Frog nmt1 Antibody (MO-AB-05673H)
CBMOAB-37447FYCMouse Anti-Arabidopsis NMT1 Antibody (CBMOAB-37447FYC)
MO-AB-23532HMouse Anti-Mallard NMT1 Antibody (MO-AB-23532H)
MO-AB-33493HMouse Anti-Nile tilapia nmt1 Antibody (MO-AB-33493H)
MO-AB-27771RMouse Anti-Pig NMT1 Antibody (MO-AB-27771R)
MO-AB-45795WMouse Anti-Horse NMT1 Antibody (MO-AB-45795W)
CBMOAB-52784FYAMouse Anti-Rhesus NMT1 Antibody (CBMOAB-52784FYA)
CBMOAB-07605HCBMouse Anti-C. elegans NMT1 Antibody (CBMOAB-07605HCB)
For Research Use Only | Not For Clinical Use.
Online Inquiry