Mouse Anti-Cattle NR3C1 Antibody (MO-AB-16928R)
Cat: MO-AB-16928R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Cattle (Bos taurus) |
Clone | MO16928R |
Specificity | This antibody binds to Cattle NR3C1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Receptor for glucocorticoids (GC). Has a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE), both for nuclear and mitochondrial DNA, and as a modulator of other transcription factors. Affects inflammatory responses, cellular proliferation and differentiation in target tissues. Involved in chromatin remodeling. Plays a role in rapid mRNA degradation by binding to the 5'' UTR of target mRNAs and interacting with PNRC2 in a ligand-dependent manner which recruits the RNA helicase UPF1 and the mRNA-decapping enzyme DCP1A, leading to RNA decay. Could act as a coactivator for STAT5-dependent transcription upon growth hormone (GH) stimulation and could reveal an essential role of hepatic GR in the control of body growth. Mediates glucocorticoid-induced apoptosis. Promotes accurate chromosome segregation during mitosis. May act as a tumor suppressor. May play a negative role in adipogenesis through the regulation of lipolytic and antilipogenic gene expression. |
Product Overview | This product is a mouse antibody against NR3C1. It can be used for NR3C1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | NR3C1 protein, Fragment; NR3C1 |
UniProt ID | Q3T0X1 |
Protein Refseq | The length of the protein is 500 amino acids long. The sequence is show below: MDPKESLSTPSREEIPSSVLGRERGNVMDFYKTLRGGATVKVSASSPSLAAASQSDSKQQRLLVDFPKGSGSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDFRLLEESIANLNRSTSVPENPKNSASTAVSAAPTEKEFPKTHSDVSSEQQNLKGQKGSNGGNMKLYTTDQSTFDIWRKKLQDLEFSSGSPSKETSESPWSSDLLIDENCLLSPLAGEDDPFLLEGSSNEDCKPLVL. |
See other products for " NR3C1 "
MO-AB-08997Y | Mouse Anti-Rabbit NR3C1 Antibody (MO-AB-08997Y) |
MO-AB-27840R | Mouse Anti-Pig NR3C1 Antibody (MO-AB-27840R) |
MO-NAB-00478W | Rabbit Anti-NR3C1 Antibody |
MO-AB-45811W | Mouse Anti-Horse NR3C1 Antibody (MO-AB-45811W) |
MO-AB-42172W | Mouse Anti-Guinea pig NR3C1 Antibody (MO-AB-42172W) |
MO-AB-01075R | Mouse Anti-Medaka nr3c1 Antibody (MO-AB-01075R) |
CBMOAB-89903FYA | Mouse Anti-Zebrafish nr3c1 Antibody (CBMOAB-89903FYA) |
MO-AB-05763H | Mouse Anti-Frog nr3c1 Antibody (MO-AB-05763H) |
MO-DKB-03618W | Rabbit Anti-NR3C1 (AA 1-150, clone ms2109-026) Antibody (Cat MO-DKB-03618W) |
MO-AB-60301W | Mouse Anti-Marmoset NR3C1 Antibody (MO-AB-60301W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry