Mouse Anti-Cattle NR3C1 Antibody (MO-AB-16928R)


Cat: MO-AB-16928R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO16928R
SpecificityThis antibody binds to Cattle NR3C1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionReceptor for glucocorticoids (GC). Has a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE), both for nuclear and mitochondrial DNA, and as a modulator of other transcription factors. Affects inflammatory responses, cellular proliferation and differentiation in target tissues. Involved in chromatin remodeling. Plays a role in rapid mRNA degradation by binding to the 5'' UTR of target mRNAs and interacting with PNRC2 in a ligand-dependent manner which recruits the RNA helicase UPF1 and the mRNA-decapping enzyme DCP1A, leading to RNA decay. Could act as a coactivator for STAT5-dependent transcription upon growth hormone (GH) stimulation and could reveal an essential role of hepatic GR in the control of body growth. Mediates glucocorticoid-induced apoptosis. Promotes accurate chromosome segregation during mitosis. May act as a tumor suppressor. May play a negative role in adipogenesis through the regulation of lipolytic and antilipogenic gene expression.
Product OverviewThis product is a mouse antibody against NR3C1. It can be used for NR3C1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNR3C1 protein, Fragment; NR3C1
UniProt IDQ3T0X1
Protein RefseqThe length of the protein is 500 amino acids long.
The sequence is show below: MDPKESLSTPSREEIPSSVLGRERGNVMDFYKTLRGGATVKVSASSPSLAAASQSDSKQQRLLVDFPKGSGSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDFRLLEESIANLNRSTSVPENPKNSASTAVSAAPTEKEFPKTHSDVSSEQQNLKGQKGSNGGNMKLYTTDQSTFDIWRKKLQDLEFSSGSPSKETSESPWSSDLLIDENCLLSPLAGEDDPFLLEGSSNEDCKPLVL.
For Research Use Only | Not For Clinical Use.
Online Inquiry