Mouse Anti-Cattle TARDBP Antibody (MO-AB-21267R)


Cat: MO-AB-21267R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO21267R
SpecificityThis antibody binds to Cattle TARDBP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTAR DNA-binding protein 43 (TDP-43, response to DNA-binding protein 43 kDa) is a protein encoded by the TARDBP gene in humans.

TDP-43 has been shown to bind DNA and RNA, and has multiple functions in transcriptional suppression, pre-mRNA splicing and translation regulation. Recent work has characterized the binding sites of the entire transcriptome, revealing that thousands of RNAs in neurons are bound by TDP-43.

TDP-43 was originally identified as a transcriptional repressor, which binds to chromosomally integrated transactivation response element (TAR) DNA and inhibits HIV-1 transcription. It is reported that it can also regulate the alternative splicing of CFTR gene and apoA-II gene.
Product OverviewThis product is a mouse antibody against TARDBP. It can be used for TARDBP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTAR DNA binding protein; TARDBP
UniProt IDQ2KJ45
Protein RefseqThe length of the protein is 298 amino acids long.
The sequence is show below: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDIKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSPDEPLRSRKVFVGRCTEDMTADELRQFFCQYGEVVDVFIPKPFRAFAFVTFADDQVAQSLCGEDLIIKGISV.
For Research Use Only | Not For Clinical Use.
Online Inquiry