AibGenesis™ Mouse Anti-TLDC2 Antibody (MO-AB-21636R)


Cat: MO-AB-21636R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-21636R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO21636R 100 µg
MO-AB-29481H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29481C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO21636R
SpecificityThis antibody binds to Cattle TLDC2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against TLDC2. It can be used for TLDC2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTLD domain-containing protein 2; TBC/LysM-associated domain-containing protein 2; TLDC2
UniProt IDQ0IID2
Protein RefseqThe length of the protein is 217 amino acids long.
The sequence is show below: MKSLRWRYTRLPSQVEDALSGEEDKEEEEEKEEETTPAPTPVPEHPMVPQLAGASQVLGASEMSQLSLHLPPRVTGYSWSLAFCTSRDGFSLQSLYRQMEGHSGPVLLVLRDQDGQMFGAFSSSALRLSKGFYGTGETFLFSFSPQLKVFKWTGSNSFFVKGDLDSLMMGCGSGRFGLWLDGDLYRGGSHPCATFNNEVLARQEQFCISELEAWVLS.
For Research Use Only | Not For Clinical Use.
Online Inquiry