Mouse Anti-Cattle TP53 Antibody (MO-AB-22056R)


Cat: MO-AB-22056R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO22056R
SpecificityThis antibody binds to Cattle TP53.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Cytosol; Cytoskeleton; Mitochondrion; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionActs as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. One of the activated genes is an inhibitor of cyclin-dependent kinases. Apoptosis induction seems to be mediated either by stimulation of BAX and FAS antigen expression, or by repression of Bcl-2 expression. Its pro-apoptotic activity is activated via its interaction with PPP1R13B/ASPP1 or TP53BP2/ASPP2 (By similarity). However, this activity is inhibited when the interaction with PPP1R13B/ASPP1 or TP53BP2/ASPP2 is displaced by PPP1R13L/iASPP (By similarity). In cooperation with mitochondrial PPIF is involved in activating oxidative stress-induced necrosis; the function is largely independent of transcription. Prevents CDK7 kinase activity when associated to CAK complex in response to DNA damage, thus stopping cell cycle progression. Induces the transcription of long intergenic non-coding RNA p21 (lincRNA-p21) and lincRNA-Mkln1. LincRNA-p21 participates in TP53-dependent transcriptional repression leading to apoptosis and seems to have an effect on cell-cycle regulation. Regulates the circadian clock by repressing CLOCK-ARNTL/BMAL1-mediated transcriptional activation of PER2.
Product OverviewThis product is a mouse antibody against TP53. It can be used for TP53 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCellular tumor antigen p53; TP53
UniProt IDF1SY23
Protein RefseqThe length of the protein is 386 amino acids long.
The sequence is show below: MEESQAELNVEPPLSQETFSDLWNLLPENNLLSSELSAPVDDLLPYTDVATWLDECPNEAPQMPEPSAPAAPPPATPAPATSWPLSSFVPSQKTYPGNYGFRLGFLQSGTAKSVTCTYSPSLNKLFCQLAKTCPVQLWVDSPPPPGTRVRAMAIYKKLEHMTEVVRRCPHHERSSDYSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYESPEIDSECTTIHYNFMCNSSCMGGMNRRPILTIITLEDSCG.
See other products for " TP53 "
MO-AB-08917WMouse Anti-Cat TP53 Antibody (MO-AB-08917W)
MO-AB-01778RMouse Anti-Medaka TP53 Antibody (MO-AB-01778R)
MO-AB-15903WMouse Anti-Chimpanzee TP53 Antibody (MO-AB-15903W)
MO-AB-33798WMouse Anti-Dog TP53 Antibody (MO-AB-33798W)
MO-AB-46888WMouse Anti-Horse TP53 Antibody (MO-AB-46888W)
MO-AB-08632HMouse Anti-Frog tp53 Antibody (MO-AB-08632H)
CBMOAB-10409FYBMouse Anti-Zebrafish tp53 Antibody (CBMOAB-10409FYB)
CBMOAB-60875FYAMouse Anti-Rhesus TP53 Antibody (CBMOAB-60875FYA)
MO-NAB-00332WRabbit Anti-TP53 Antibody (AA 1-100)
MO-NAB-00233WMouse Anti-Yeast TP53 (AA 14-389, clone NW0129) Antibody (MO-NAB-00233W)
For Research Use Only | Not For Clinical Use.
Online Inquiry