Mouse Anti-CAV1 Antibody (CBMOAB-01096HCB)
Cat: CBMOAB-01096HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-01096HCB | Monoclonal | C. elegans (Caenorhabditis elegans), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Frog (Xenopus laevis), Goat, Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus, Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO01096HB | 100 µg | ||
CBMOAB-69148FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO69148FYA | 100 µg | ||
MO-AB-00178L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00178L | 100 µg | ||
MO-AB-00995Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO00995Y | 100 µg | ||
MO-AB-02101H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02101C | 100 µg | ||
MO-AB-07450Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07450Y | 100 µg | ||
MO-AB-09069W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO09069W | 100 µg | ||
MO-AB-09559R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO09559R | 100 µg | ||
MO-AB-14467Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14467Y | 100 µg | ||
MO-AB-23012H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23012C | 100 µg | ||
MO-AB-23752W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO23752W | 100 µg | ||
MO-AB-24345R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24345R | 100 µg | ||
MO-AB-24517H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24517C | 100 µg | ||
MO-AB-29347W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29347W | 100 µg | ||
MO-AB-32894H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO32894C | 100 µg | ||
MO-AB-41348W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41348W | 100 µg | ||
MO-AB-43914W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO43914W | 100 µg | ||
MO-AB-52298W | Monoclonal | Marmoset | WB, ELISA | MO52298W | 100 µg | ||
MOFY-0722-FY126 | Polyclonal | Rhesus | WB, IHC, ICC, IP | 100 µg | |||
MOFY-0722-FY419 | Polyclonal | Goat | WB, IHC, ICC, IP | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | C. elegans (Caenorhabditis elegans), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Frog (Xenopus laevis), Goat, Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus, Sheep (Ovis aries), Zebrafish (Danio rerio) |
Clone | MO01096HB |
Specificity | This antibody binds to C. elegans CAV1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 mitogen-activated kinase cascade. Caveolin 1 and caveolin 2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Mutations in this gene have been associated with Berardinelli-Seip congenital lipodystrophy. Alternatively spliced transcripts encode alpha and beta isoforms of caveolin 1. (From NCBI) |
Product Overview | Mouse Anti-C. elegans CAV1 Antibody is a mouse antibody against CAV1. It can be used for CAV1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Protein CAV-1, isoform c; cav-1 |
UniProt ID | I2HAL2 |
Protein Refseq | The length of the protein is 276 amino acids long. The sequence is show below: MRLCNVWNARQINVGQMDNNKLQMDFVYQCVRIQNFITHFIMSTEQDIKTEEQIPLTYAAVAAPTVQTEGEAVVAPEEPKPKKNWFTFGKKKAAPTDETNIEEGGAPGDEPVKEKKEKKCWWSRCQKGEGEQKEENIAIGVDLVNRDANSMNNHVQLNFEDIFGEADSQHSWDCVWRLNHTVFTAVRLFIYRLVSLLALPFTIIFAIFFGLLASINVFIIVPLGKLLSIPGTLLAKLWNWLIHAIFDPIASAVGLIFSNFNIRKYGINQETTAPCV. |
For Research Use Only | Not For Clinical Use.
Online Inquiry