Mouse Anti-CAV1 Antibody (CBMOAB-01096HCB)


Cat: CBMOAB-01096HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-01096HCB Monoclonal C. elegans (Caenorhabditis elegans), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Frog (Xenopus laevis), Goat, Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus, Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO01096HB 100 µg
CBMOAB-69148FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69148FYA 100 µg
MO-AB-00178L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00178L 100 µg
MO-AB-00995Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO00995Y 100 µg
MO-AB-02101H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02101C 100 µg
MO-AB-07450Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07450Y 100 µg
MO-AB-09069W Monoclonal Cat (Felis catus) WB, ELISA MO09069W 100 µg
MO-AB-09559R Monoclonal Cattle (Bos taurus) WB, ELISA MO09559R 100 µg
MO-AB-14467Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14467Y 100 µg
MO-AB-23012H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23012C 100 µg
MO-AB-23752W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23752W 100 µg
MO-AB-24345R Monoclonal Pig (Sus scrofa) WB, ELISA MO24345R 100 µg
MO-AB-24517H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24517C 100 µg
MO-AB-29347W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29347W 100 µg
MO-AB-32894H Monoclonal Nile tilapia (Oreochromis niloticus) WB, ELISA MO32894C 100 µg
MO-AB-41348W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41348W 100 µg
MO-AB-43914W Monoclonal Horse (Equus caballus) WB, ELISA MO43914W 100 µg
MO-AB-52298W Monoclonal Marmoset WB, ELISA MO52298W 100 µg
MOFY-0722-FY126 Polyclonal Rhesus WB, IHC, ICC, IP 100 µg
MOFY-0722-FY419 Polyclonal Goat WB, IHC, ICC, IP 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityC. elegans (Caenorhabditis elegans), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Frog (Xenopus laevis), Goat, Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus, Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO01096HB
SpecificityThis antibody binds to C. elegans CAV1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 mitogen-activated kinase cascade. Caveolin 1 and caveolin 2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Mutations in this gene have been associated with Berardinelli-Seip congenital lipodystrophy. Alternatively spliced transcripts encode alpha and beta isoforms of caveolin 1.
Product OverviewMouse Anti-C. elegans CAV1 Antibody is a mouse antibody against CAV1. It can be used for CAV1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein CAV-1, isoform c; cav-1
UniProt IDI2HAL2
Protein RefseqThe length of the protein is 276 amino acids long. The sequence is show below: MRLCNVWNARQINVGQMDNNKLQMDFVYQCVRIQNFITHFIMSTEQDIKTEEQIPLTYAAVAAPTVQTEGEAVVAPEEPKPKKNWFTFGKKKAAPTDETNIEEGGAPGDEPVKEKKEKKCWWSRCQKGEGEQKEENIAIGVDLVNRDANSMNNHVQLNFEDIFGEADSQHSWDCVWRLNHTVFTAVRLFIYRLVSLLALPFTIIFAIFFGLLASINVFIIVPLGKLLSIPGTLLAKLWNWLIHAIFDPIASAVGLIFSNFNIRKYGINQETTAPCV.
For Research Use Only | Not For Clinical Use.
Online Inquiry