Mouse Anti-CBF7 Antibody (MO-AB-00080W)


Cat: MO-AB-00080W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-00080W Monoclonal Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris) WB, ELISA MO00080W 100 µg
MO-AB-01800L Monoclonal Bromus (Bromus vulgaris) WB, ELISA MO01800L 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityBarrel medic (Medicago truncatula), Bromus (Bromus vulgaris)
CloneMO00080W
SpecificityThis antibody binds to Barrel medic CBF7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Barrel medic CBF7 Antibody is a mouse antibody against CBF7. It can be used for CBF7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC-repeat binding factor 7; CBF7
UniProt IDS5MAC4
Protein RefseqThe length of the protein is 245 amino acids long.
The sequence is show below: MFTTNNSSYSHSIPSTASSSYDMSTPNSEVRLAASNPKKRAGRKIFKETRHPMYRGVRKRNLDKWVCEMREPNTKTRIWLGTFPTPEMAARAHDVAAMALRGRYACLNYADSVWRLPIPATSAIKDIQKAAAEAAEAFRPDKTLMINDIDTVVPVAATKELNMFCVEVEEEQEMLNMPELLRNMALMSPTHSFEYHDQYEDIHVQDFQDDEDFKKKSVTTIWAVTAIGVHTPHFTVISRIVIVSV.
For Research Use Only | Not For Clinical Use.
Online Inquiry