Mouse Anti-CBLN1 Antibody (CBMOAB-38230FYA)


Cat: CBMOAB-38230FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38230FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO38230FYA 100 µg
CBMOAB-69176FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69176FYA 100 µg
MO-AB-52309W Monoclonal Marmoset WB, ELISA MO52309W 100 µg
MO-AB-24354R Monoclonal Pig (Sus scrofa) WB, ELISA MO24354R 100 µg
MO-AB-24526H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24526C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO38230FYA
SpecificityThis antibody binds to Rhesus CBLN1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a cerebellum-specific precursor protein, precerebellin, with similarity to the globular (non-collagen-like) domain of complement component C1qB. Precerebellin is processed to give rise to several derivatives, including the hexadecapeptide, cerebellin, which is highly enriched in postsynaptic structures of Purkinje cells. Cerebellin has also been found in human and rat adrenals, where it has been shown to enhance the secretory activity of this gland.
Product OverviewMouse Anti-Rhesus CBLN1 Antibody is a mouse antibody against CBLN1. It can be used for CBLN1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCerebellin-1; CBLN1
UniProt IDH9FIA8
Protein RefseqThe length of the protein is 122 amino acids long.
The sequence is show below: STNHEPSEMSNRTMIIYFDQVLVNIGSNFDSERSTFIAPRKGIYSFNFHVVKVYNRQTIQVSLMLNGWPVISAFAGDQDVTREAASNGVLIQMEKGDRAYLKLERGNLMGGWKYSTVSGFLV.
For Research Use Only | Not For Clinical Use.
Online Inquiry