Mouse Anti-CCK Antibody (CBMOAB-38534FYA)


Cat: CBMOAB-38534FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38534FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO38534FYA 100 µg
MO-AB-01011Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01011Y 100 µg
MO-AB-03480W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03480W 100 µg
MO-AB-09682R Monoclonal Cattle (Bos taurus) WB, ELISA MO09682R 100 µg
MO-AB-24366R Monoclonal Pig (Sus scrofa) WB, ELISA MO24366R 100 µg
MO-AB-24570H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24570C 100 µg
MO-AB-29390W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29390W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO38534FYA
SpecificityThis antibody binds to Rhesus CCK.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCCK (Cholecystokinin) is a Protein Coding gene. Diseases associated with CCK include Biliary Dyskinesia and Cholecystitis. Among its related pathways are Cell-type Dependent Selectivity of CCK2R Signaling and Peptide ligand-binding receptors. Gene Ontology (GO) annotations related to this gene include hormone activity and neuropeptide hormone activity.
Product OverviewMouse Anti-Rhesus CCK Antibody is a mouse antibody against CCK. It can be used for CCK detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCholecystokinin preproprotein; CCK
UniProt IDI2CYX5
Protein RefseqThe length of the protein is 115 amino acids long.
The sequence is show below: MNSGVRLCVLMAVLAAGALTQPVPPAEPAGSGLQRAEEAPRRQLRAVQRTDGESRAHLGALLARYIQQARKAPSGRMSIIKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS.
For Research Use Only | Not For Clinical Use.
Online Inquiry