Mouse Anti-CCL8 Antibody (CBMOAB-38552FYA)


Cat: CBMOAB-38552FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38552FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Horse (Equus caballus), Pig (Sus scrofa), Sheep (Ovis aries) WB, ELISA MO38552FYA 100 µg
MO-AB-03483W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03483W 100 µg
MO-AB-08663W Monoclonal Cat (Felis catus) WB, ELISA MO08663W 100 µg
MO-AB-09704R Monoclonal Cattle (Bos taurus) WB, ELISA MO09704R 100 µg
MO-AB-14482Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14482Y 100 µg
MO-AB-19900W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19900W 100 µg
MO-AB-24392R Monoclonal Pig (Sus scrofa) WB, ELISA MO24392R 100 µg
MO-AB-29423W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29423W 100 µg
MO-AB-43933W Monoclonal Horse (Equus caballus) WB, ELISA MO43933W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Horse (Equus caballus), Pig (Sus scrofa), Sheep (Ovis aries)
CloneMO38552FYA
SpecificityThis antibody binds to Rhesus CCL8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCCL8 (C-C Motif Chemokine Ligand 8) is a Protein Coding gene. Diseases associated with CCL8 include Diffuse Gastric Cancer. Among its related pathways are PEDF Induced Signaling and Akt Signaling. Gene Ontology (GO) annotations related to this gene include protein kinase activity and chemokine activity. An important paralog of this gene is CCL11.
Product OverviewMouse Anti-Rhesus CCL8 Antibody is a mouse antibody against CCL8. It can be used for CCL8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC-C motif chemokine; CCL8
UniProt IDF6Y1K4
Protein RefseqThe length of the protein is 99 amino acids long.
The sequence is show below: MKVSAALLCLLLMAATFSPQGLAQPDSVSIPITCCFNVINRKIPIQRLQSYTRITNTQCPKEAVIFKTKWGKEVCADPKERWVRDSMKHLDQMFQNLKP.
For Research Use Only | Not For Clinical Use.
Online Inquiry