Mouse Anti-CCR5 Antibody (CBMOAB-38590FYA)
Cat: CBMOAB-38590FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-38590FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Donkey (Equus asinus), Elephant (Loxodonta africana), Goat (Capra hircus), Gorilla, Horse (Equus caballus), Human (Homo sapiens), Virus, Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) | WB, ELISA | MO38590FYA | 100 µg | ||
MO-AB-00189L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00189L | 100 µg | ||
MO-AB-01029Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO01029Y | 100 µg | ||
MO-AB-07493Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07493Y | 100 µg | ||
MO-AB-07505Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07505Y | 100 µg | ||
MO-AB-08254W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08254W | 100 µg | ||
MO-AB-09738R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO09738R | 100 µg | ||
MO-AB-14483Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14483Y | 100 µg | ||
MO-AB-15525W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO15525W | 100 µg | ||
MO-AB-24409R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24409R | 100 µg | ||
MO-AB-26831W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO26831W | 100 µg | ||
MO-AB-29434W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29434W | 100 µg | ||
MO-AB-34175W | Monoclonal | Donkey (Equus asinus) | WB, ELISA | MO34175W | 100 µg | ||
MO-AB-36873W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO36873W | 100 µg | ||
MO-AB-38460W | Monoclonal | Gorilla | WB, ELISA | MO38460W | 100 µg | ||
MO-AB-43952W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO43952W | 100 µg | ||
MO-AB-52501W | Monoclonal | Marmoset | WB, ELISA | MO52501W | 100 µg | ||
MO-DKB-01118W | Polyclonal | Human (Homo sapiens), Rhesus (Macaca mulatta), Virus | WB, ELISA, IHC, IHC-P | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Donkey (Equus asinus), Elephant (Loxodonta africana), Goat (Capra hircus), Gorilla, Horse (Equus caballus), Human (Homo sapiens), Virus, Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) |
Clone | MO38590FYA |
Specificity | This antibody binds to Rhesus CCR5. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | CCR5 (C-C Motif Chemokine Receptor 5 (Gene/Pseudogene)) is a Protein Coding gene. Diseases associated with CCR5 include West Nile Virus and Diabetes Mellitus, Insulin-Dependent, 22. Among its related pathways are Cytokine Signaling in Immune system and Akt Signaling. Gene Ontology (GO) annotations related to this gene include G-protein coupled receptor activity and phosphatidylinositol phospholipase C activity. An important paralog of this gene is CCR2. |
Product Overview | Mouse Anti-Rhesus CCR5 Antibody is a mouse antibody against CCR5. It can be used for CCR5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | CC chemokine receptor 5; CCR5 |
UniProt ID | Q09GY8 |
Protein Refseq | The length of the protein is 352 amino acids long. The sequence is show below: MDYQVSSPTYDIDYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKRLKSMTDIYLLNLAISDLLFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSSHFPYSQYQFWKNFQTLKMVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFPKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry