Mouse Anti-CCRL2 Antibody (CBMOAB-38605FYA)


Cat: CBMOAB-38605FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38605FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO38605FYA 100 µg
MO-AB-03485W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03485W 100 µg
MO-AB-09746R Monoclonal Cattle (Bos taurus) WB, ELISA MO09746R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO38605FYA
SpecificityThis antibody binds to Rhesus CCRL2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCCRL2 (C-C Motif Chemokine Receptor Like 2) is a Protein Coding gene. Among its related pathways are Akt Signaling and Peptide ligand-binding receptors. Gene Ontology (GO) annotations related to this gene include G-protein coupled receptor activity and chemokine receptor binding.
Product OverviewMouse Anti-Rhesus CCRL2 Antibody is a mouse antibody against CCRL2. It can be used for CCRL2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC-C chemokine receptor-like 2; CCRL2
UniProt IDF7BZ03
Protein RefseqThe length of the protein is 349 amino acids long.
The sequence is show below: QGSLNMANYTLAPEDEYDVLIEGELESDEAEQCDRYDTWALSAQLVPSLCSAVFVVGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFFNCLLTVQRYLVFLHKGNFFSVRRRVPCGIVTSAVAWVTAILATVPEFAVYKPQMEDPKYKCAFSRTPFLPADETFWKHFLTLKMNVSVLVFPLFIFTFLYVQMRKTLRFGEQRYSLFKLVFAIMVVFLLMWAPYNIALFLSTFKEHFSLSDCKSNYNLDKSVLITKLIATTHCCVNPLLYVFLDGTFRKYLCRFFHRRSNTPRQPRRRFAQGTSREEPDRSTEV.
For Research Use Only | Not For Clinical Use.
Online Inquiry