Mouse Anti-CDC37 Antibody (MO-AB-69457W)


Cat: MO-AB-69457W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-69457W Monoclonal Silkworm (Bombyx mori), C. elegans (Caenorhabditis elegans), Fruit fly (Drosophila melanogaster), Pig (Sus scrofa), Rhesus (Macaca mulatta) WB, ELISA MO69457W 100 µg
CBMOAB-03251FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO03251FYA 100 µg
CBMOAB-38788FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO38788FYA 100 µg
CBMOAB-01165HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO01165HB 100 µg
MO-AB-24517R Monoclonal Pig (Sus scrofa) WB, ELISA MO24517R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivitySilkworm (Bombyx mori), C. elegans (Caenorhabditis elegans), Fruit fly (Drosophila melanogaster), Pig (Sus scrofa), Rhesus (Macaca mulatta)
CloneMO69457W
SpecificityThis antibody binds to Silkworm CDC37.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCDC37 (Cell Division Cycle 37) is a Protein Coding gene. Among its related pathways are Aryl Hydrocarbon Receptor and Signaling by Ligand-Responsive EGFR Variants in Cancer. Gene Ontology (GO) annotations related to this gene include protein kinase binding and kinase binding. An important paralog of this gene is CDC37L1.
Product OverviewMouse Anti-Silkworm CDC37 Antibody is a mouse antibody against CDC37. It can be used for CDC37 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHSP90 cochaperone CDC37 homologue; CDC37
UniProt IDQ5CCL4
Protein RefseqThe length of the protein is 372 amino acids long.
The sequence is show below: MVDYSKWKDIEISDDEDETHPNIDTPSLFRWRHQARVERMEERRREKEELEQRKKENQRRLTETRKKISEADADSPNLNSLXKMLAELENDEKKILKRDEELRKKDKHTPWNVDTISEPGFNKTVINTKALRPSNENLTEEEKEAKMKKFIKENEKFLKQFGLLRKYEDSTKFLLDHNQLVCEETANYLVIWCINLEMEEKHDLMSHVAHQTICMQYILELSRQLDVDPRACVGSFFSKIQTAEQAYKDAFEDELKQFKIRIKKRAAEKIQEAIKEAEEEERKARLGPGGLDPVEVYEELPDELKKCFDAQDVPMLQATIAKIPQEEAIYYMNRCIASGLWVPGKNDEEPTMKDSKTEKHSGETSTNANDVD.
For Research Use Only | Not For Clinical Use.
Online Inquiry