Mouse Anti-Chicken CD4 Antibody (MO-AB-01062Y)
Cat: MO-AB-01062Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Chicken (Gallus gallus) |
Clone | MO01062Y |
Specificity | This antibody binds to Chicken CD4. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Plasma membrane; Endoplasmic reticulum |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class II molecule:peptide complex. The antigens presented by class II peptides are derived from extracellular proteins while class I peptides are derived from cytosolic proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class II presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK then initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of T-helper cells. In other cells such as macrophages or NK cells, plays a role in differentiation/activation, cytokine expression and cell migration in a TCR/LCK-independent pathway. Participates in the development of T-helper cells in the thymus and triggers the differentiation of monocytes into functional mature macrophages. |
Product Overview | This product is a mouse antibody against CD4. It can be used for CD4 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | CD4; CD4 protein |
UniProt ID | Q9W6V7 |
Protein Refseq | The length of the protein is 487 amino acids long. The sequence is show below: MERCGAVVSCVFAVILVLQLGLTPIMAQQEQQIGIAGKEVILSCKAINNQKDGTCTWKYKYKEVSSTIISFSKAQVFKGKAPMTHRSELNSNSKKLKVSDLSLDDAGIYTCACYSPVVSISLHVFKLTISSNGHFLTNEDLELTLMQNSSHSQPHLSIKLFNINNDIVTTEILQEEAPQKYILKLKQLKAIDSGTWMCHVYSNSPSINQNISFDVKVLGFEKERLEIIYTTVGNTAILSWRLNFRKIKWKEGFTGKLNWEPQGNTAIHELLNFSVTTHQELHKTKKSNHIWFEISEGKTDGTMDVKIPKVQLNHSGQYKCQLEINGRRTESVRALVVMQVTAIPAGPLSRGGKMTLLCQVSGPLPSNAHLLWERVNGTQMEMKKSKQHEAKVEVNVSAPGLWNCHLVEDNNKKISLNYTVEEAHVWNSYAVIGIIIGASVLVIGLACMCIITGMRWQRRRKRARRMAQAKQYLLEKKTCQCQRRMYK. |
Reference
Reference | 1. Luhtala, M. (1998). Chicken CD4, CD8alphabeta, and CD8alphaalpha T cell co-receptor molecules. Poultry Science, 77(12), 1858-1873. 2. Koskinen, R., Salomonsen, J., Tregaskes, C. A., Young, J. R., Goodchild, M., Bumstead, N., & Vainio, O. (2002). The chicken CD4 gene has remained conserved in evolution. Immunogenetics, 54, 520-525. |
See other products for " CD4 "
MO-AB-14502Y | Mouse Anti-Sheep CD4 Antibody (MO-AB-14502Y) |
MO-AB-36875W | Mouse Anti-Goat CD4 Antibody (MO-AB-36875W) |
MO-NAB-00315W | Rat Anti-Mouse CD4 Antibody |
CBMOAB-00060FYA | Mouse Anti-Cattle CD4 Antibody (CBMOAB-00060FYA) |
CBMOAB-00141FYA | Mouse Anti-Goat CD4 Antibody (CBMOAB-00141FYA) |
MOFY-0622-FY175 | Rabbit Anti-CD4 Antibody (MOFY-0622-FY175) |
MOFY-0522-FY71 | Mouse Anti-CD4 Antibody (MOFY-0522-FY71) |
CBMOAB-00150FYA | Mouse Anti-Horse CD4 Antibody (CBMOAB-00150FYA) |
MOFY-0522-FY52 | Mouse Anti-CD4 Antibody (MOFY-0522-FY52) |
MO-AB-00183R | Mouse Anti-Medaka CD4 Antibody (MO-AB-00183R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry