Mouse Anti-Chicken FGB Antibody (MO-AB-01881Y)
Cat: MO-AB-01881Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Chicken (Gallus gallus) |
Clone | MO01881Y |
Specificity | This antibody binds to Chicken FGB. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Extracellular region or secreted; Plasma membrane; Endoplasmic reticulum |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Cleaved by the protease thrombin to yield monomers which, together with fibrinogen alpha (FGA) and fibrinogen gamma (FGG), polymerize to form an insoluble fibrin matrix. Fibrin has a major function in hemostasis as one of the primary components of blood clots. In addition, functions during the early stages of wound repair to stabilize the lesion and guide cell migration during re-epithelialization. Was originally thought to be essential for platelet aggregation, based on in vitro studies using anticoagulated blood. However subsequent studies have shown that it is not absolutely required for thrombus formation in vivo. Enhances expression of SELP in activated platelets. Maternal fibrinogen is essential for successful pregnancy. Fibrin deposition is also associated with infection, where it protects against IFNG-mediated hemorrhage. May also facilitate the antibacterial immune response via both innate and T-cell mediated pathways. |
Product Overview | This product is a mouse antibody against FGB. It can be used for FGB detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Fibrinogen beta chain; FGB |
UniProt ID | F1NUL9 |
Protein Refseq | The length of the protein is 480 amino acids long. The sequence is show below: MKLLLLLLLCIPAIKPQASVEYDNEEDSPQIDARAHRPLDKRQEAAPTLRPVAPPISGTGYQPRPPKQDKQAMKKGPIIYPDAGGCKHPLDELGVLCPTGCELQTTLLKQEKTVKPVLRDLKDRVAKFSDTSTTMYQYVNMIDNKLVKTQKQRKDNDIILSEYNTEMELHYNYIKDNLDNNIPSSLRVLRAVIDSLHKKIQKLENAIATQTDYCRSPCVASCNIPVVSGRECEDIYRKGGETSEMYIIQPDPFTTPYRVYCDMETDNGGWTLIQNRQDGSVNFGRAWDEYKRGFGNIAKSGGKKYCDTPGEYWLGNDKISQLTKIGPTKVLIEMEDWNGDKVSALYGGFTIHNEGNKYQLSVSNYKGNAGNALMEGASQLYGENRTMTIHNGMYFSTYDRDNDGWLTTDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGTYSWDMAKHGTDDGIVWMNWKGSWYSMKKMSMKIKPYFPD. |
See other products for " fgb "
MO-AB-03571H | Mouse Anti-Frog fgb Antibody (MO-AB-03571H) |
MO-AB-25818R | Mouse Anti-Pig FGB Antibody (MO-AB-25818R) |
MO-AB-08065Y | Mouse Anti-Rabbit FGB Antibody (MO-AB-08065Y) |
MO-AB-34239W | Mouse Anti-Donkey FGB Antibody (MO-AB-34239W) |
MO-AB-12505R | Mouse Anti-Cattle FGB Antibody (MO-AB-12505R) |
MO-AB-09655W | Mouse Anti-Cat FGB Antibody (MO-AB-09655W) |
MO-AB-23213H | Mouse Anti-Mallard FGB Antibody (MO-AB-23213H) |
MO-AB-37199W | Mouse Anti-Goat FGB Antibody (MO-AB-37199W) |
MO-AB-44732W | Mouse Anti-Horse FGB Antibody (MO-AB-44732W) |
CBMOAB-76365FYA | Mouse Anti-Zebrafish fgb Antibody (CBMOAB-76365FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry