Mouse Anti-Chimpanzee A4GALT Antibody (MO-AB-24027W)


Cat: MO-AB-24027W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO24027W
SpecificityThis antibody binds to Chimpanzee A4GALT.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene catalyzes the transfer of galactose to lactosylceramide to form globotriaosylceramide, which has been identified as the P(k) antigen of the P blood group system. This protein, a type II membrane protein found in the Golgi, is also required for the synthesis of the bacterial verotoxins receptor. Alternatively spliced transcript variants have been found for this gene.
Product OverviewMouse Anti-Chimpanzee A4GALT (clone MO24027W) Antibody (MO-AB-24027W) is a mouse antibody against A4GALT. It can be used for A4GALT detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLactosylceramide 4-alpha-galactosyltransferase; A4GALT
UniProt IDH2RBI4
Protein RefseqThe length of the protein is 345 amino acids long.
The sequence is show below: MSKPPDLLLRLLRGAPRQRVCTLFIIGFKFTFFVSIMIYWHVVGEPKEKGQLYNLPAEIPCPTLTPPPPSHGFFLETSTGPPNFLFMCSVESAALSHPESHVLVLMKGLPGGNASLPRHLGISLLSCFPNVQMLPLDLRELFRDTPLADWYAAVQGRWEPYLLPVLSDASRIALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAFERRHQFMALCMRDFVDHYNGWIWGHQGPQLLTRVFKKWCSIRSLAESRSCRGVTTLPPEAFYPIPWQDWKKYFEDINPEELPRLLSATYAVHVWNKKSQGTRFEATSRALLAQLHARYCPTTHEAMKMYL.
For Research Use Only | Not For Clinical Use.

Online Inquiry