Mouse Anti-Chimpanzee ABO Antibody (MO-AB-26912W)


Cat: MO-AB-26912W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO26912W
SpecificityThis antibody binds to Chimpanzee ABO.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes proteins related to the first discovered blood group system, ABO. Which allele is present in an individual determines the blood group. The 'O' blood group is caused by a deletion of guanine-258 near the N-terminus of the protein which results in a frameshift and translation of an almost entirely different protein. Individuals with the A, B, and AB alleles express glycosyltransferase activities that convert the H antigen into the A or B antigen. Other minor alleles have been found for this gene.
Product OverviewMouse Anti-Chimpanzee ABO (clone MO26912W) Antibody (MO-AB-26912W) is a mouse antibody against ABO. It can be used for ABO detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHisto-blood group ABO transferase; ABO
UniProt IDO97549
Protein RefseqThe length of the protein is 274 amino acids long.
The sequence is show below: RKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCQRRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFCYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPSVLRKLRFTAVPKNHQAVRNP.

Reference

See other products for " ABO "

MO-AB-26914WMouse Anti-Chimpanzee ABO Antibody (MO-AB-26914W)
MO-AB-26913WMouse Anti-Chimpanzee ABO Antibody (MO-AB-26913W)
CBMOAB-34897FYAMouse Anti-Rhesus ABO Antibody (CBMOAB-34897FYA)
MO-AB-23462RMouse Anti-Pig ABO Antibody (MO-AB-23462R)
MO-AB-50266WMouse Anti-Marmoset ABO Antibody (MO-AB-50266W)
MO-AB-27190WMouse Anti-Chimpanzee ABO Antibody (MO-AB-27190W)
MO-AB-06816RMouse Anti-Cattle ABO Antibody (MO-AB-06816R)
CBMOAB-00510FYAMouse Anti-D. melanogaster Abo Antibody (CBMOAB-00510FYA)
CBMOAB-64527FYAMouse Anti-Zebrafish abo Antibody (CBMOAB-64527FYA)
MO-AB-23461RMouse Anti-Pig ABO Antibody (MO-AB-23461R)
For Research Use Only | Not For Clinical Use.

Online Inquiry