Mouse Anti-Chimpanzee AK1 Antibody (MO-AB-15852W)


Cat: MO-AB-15852W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO15852W
SpecificityThis antibody binds to Chimpanzee AK1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.
Product OverviewMouse Anti-Chimpanzee AK1 Antibody is a mouse antibody against AK1. It can be used for AK1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdenylate kinase isoenzyme 1; AK 1; EC 2.7.4.3; EC 2.7.4.6; ATP-AMP transphosphorylase 1; ATP:AMP phosphotransferase; Adenylate monophosphate kinase; Myokinase; AK1
UniProt IDH2R6A3
Protein RefseqThe length of the protein is 194 amino acids long.
The sequence is show below: MEEKLKKTKIIFVWGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVITFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK.
See other products for " Ak1 "
MO-AB-24012HMouse Anti-Rat Ak1 Antibody (MO-AB-24012H)
MO-AB-07128YMouse Anti-Rabbit AK1 Antibody (MO-AB-07128Y)
MO-AB-01317HMouse Anti-Frog ak1 Antibody (MO-AB-01317H)
MO-AB-08409WMouse Anti-Cat AK1 Antibody (MO-AB-08409W)
MO-AB-00035RMouse Anti-Medaka ak1 Antibody (MO-AB-00035R)
CBMOAB-65342FYAMouse Anti-Zebrafish ak1 Antibody (CBMOAB-65342FYA)
MO-AB-28901WMouse Anti-Dog AK1 Antibody (MO-AB-28901W)
MO-AB-50634WMouse Anti-Marmoset AK1 Antibody (MO-AB-50634W)
CBMOAB-35398FYAMouse Anti-Rhesus AK1 Antibody (CBMOAB-35398FYA)
MO-AB-07173RMouse Anti-Cattle AK1 Antibody (MO-AB-07173R)
For Research Use Only | Not For Clinical Use.
Online Inquiry