Mouse Anti-Chimpanzee ALG14 Antibody (MO-AB-25929W)


Cat: MO-AB-25929W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO25929W
SpecificityThis antibody binds to Chimpanzee ALG14.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the glycosyltransferase 1 family. The encoded protein and ALG13 are thought to be subunits of UDP-GlcNAc transferase, which catalyzes the first two committed steps in endoplasmic reticulum N-linked glycosylation. Mutations in this gene have been linked to congenital myasthenic syndrome (CMSWTA). Alternatively spliced transcript variants have been identified.
Product OverviewMouse Anti-Chimpanzee ALG14 Antibody is a mouse antibody against ALG14. It can be used for ALG14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAsparagine-linked glycosylation 14 homolog; ALG14
UniProt IDK7AJ24
Protein RefseqThe length of the protein is 216 amino acids long.
The sequence is show below: MVCVVILAAAAGAVAVFLILRIWVVLRSRDVTPRESLSILVVAGSGGHTTEILRLLGSLSNAYSPRHYVIADTDEMSANKINCFELDRADRDPSNMYTKYYIHRIPRSREVQQSWPSTVFTTLHSMWLSFPLIHRVKPDLVLCNGPGTCVPICVSAFLLGILGIKKVIIVYVESICRVETLSMSGKILFHLSDYFIVQWPALKEKYPKSVYLGRIV.
For Research Use Only | Not For Clinical Use.
Online Inquiry