Mouse Anti-Chimpanzee ALG2 Antibody (MO-AB-11623W)


Cat: MO-AB-11623W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO11623W
SpecificityThis antibody binds to Chimpanzee ALG2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol; Cytoskeleton; Endoplasmic reticulum; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the glycosyltransferase 1 family. The encoded protein acts as an alpha 1,3 mannosyltransferase, mannosylating Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. Defects in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ii). Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Chimpanzee ALG2 Antibody is a mouse antibody against ALG2. It can be used for ALG2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAlpha-1,3-mannosyltransferase ALG2; Asparagine-linked glycosylation 2, alpha-1,3-mannosyltransferase homolog; ALG2
UniProt IDG2HGD0
Protein RefseqThe length of the protein is 416 amino acids long.
The sequence is show below: MAEEQGRERDSVPKPSVLFLHPDLGVGGAERLVLDAALALQTRGCSVKIWTAHYDPGHCFAESRELPVRCAGDWLPRGLGWGGRGAAVCAYVRMVFLALYVLFLADEEFDVVVCDQVSACIPVFRLARRRKKILFYCHFPDLLLTKRDSFLKRLYRAPIDWIEEYTTGMADCILVNSQFTAAVFKETFKSLSHIDPDVLYPSLNVTSFDSVVPEKLDDLVPKGKKFLLLSINRYERKKNLTLALEALVQLRGRLTSQDWERVHLIVAGGYDERVLENVEHYQELKKMVQQSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQCPVIAVNSGGPLESIDHSVTGFLCEPDPVHFSEAIEKFIREPSLKATMGLAGRARVKEKFSPEAFTEQLYRYVTKLLV.
See other products for " ALG2 "
MO-AB-23685RMouse Anti-Pig ALG2 Antibody (MO-AB-23685R)
MO-AB-01367HMouse Anti-Frog alg2 Antibody (MO-AB-01367H)
MO-AB-24034HMouse Anti-Rat Alg2 Antibody (MO-AB-24034H)
CBMOAB-00215CRMouse Anti-Yeast ALG2 Antibody (CBMOAB-00215CR)
CBMOAB-00473HCBMouse Anti-C. elegans ALG2 Antibody (CBMOAB-00473HCB)
MO-AB-07248RMouse Anti-Cattle ALG2 Antibody (MO-AB-07248R)
CBMOAB-35514FYAMouse Anti-Rhesus ALG2 Antibody (CBMOAB-35514FYA)
CBMOAB-65544FYAMouse Anti-Zebrafish alg2 Antibody (CBMOAB-65544FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry