Mouse Anti-Chimpanzee CD4 Antibody (MO-AB-21077W)


Cat: MO-AB-21077W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO21077W
SpecificityThis antibody binds to Chimpanzee CD4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD4 (CD4 Molecule) is a Protein Coding gene. Diseases associated with CD4 include Okt4 Epitope Deficiency and Pilonidal Sinus. Among its related pathways are G-protein signaling N-RAS regulation pathway and PEDF Induced Signaling. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and enzyme binding.
Product OverviewMouse Anti-Chimpanzee CD4 Antibody is a mouse antibody against CD4. It can be used for CD4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesT-cell surface glycoprotein CD4; CD4
UniProt IDB0LAH6
Protein RefseqThe length of the protein is 458 amino acids long.
The sequence is show below: MNRGVPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQTKILGNQGSFLTKGPSKLXDRXDSRRSLWDQGNFXLIIKNLKIEDSDTYICEVGDQKEEVQLLVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSGTWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWWQAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLALEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWVLNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAQRMSQIKRLLSEKKTCQCPHRFQKTCSPI.

Reference

Reference1. Hvilsom, C., Carlsen, F., Siegismund, H. R., Corbet, S., Nerrienet, E., & Fomsgaard, A. (2008). Genetic subspecies diversity of the chimpanzee CD4 virus-receptor gene. Genomics, 92(5), 322-328.
2. Camerini, D., & Seed, B. (1990). A CD4 domain important for HIV-mediated syncytium formation lies outside the virus binding site. Cell, 60(5), 747-754.
See other products for " CD4 "
CBMOAB-00138FYAMouse Anti-Dog CD4 Antibody (CBMOAB-00138FYA)
MOFY-0722-FY429Rabbit Anti-CD4 Antibody (MOFY-0722-FY429)
CBMOAB-00156FYAMouse Anti-Cat CD4 Antibody (CBMOAB-00156FYA)
CBMOAB-38704FYAMouse Anti-Rhesus CD4 Antibody (CBMOAB-38704FYA)
MO-AB-23021HMouse Anti-Mallard CD4 Antibody (MO-AB-23021H)
CBMOAB-00150FYAMouse Anti-Horse CD4 Antibody (CBMOAB-00150FYA)
MOFY-0522-FY2Mouse Anti-CD4 Antibody (MOFY-0522-FY2)
MOFY-0622-FY175Rabbit Anti-CD4 Antibody (MOFY-0622-FY175)
MO-DKB-00481WRabbit Anti-CD4 Antibody (MO-DKB-00481W)
CBMOAB-00141FYAMouse Anti-Goat CD4 Antibody (CBMOAB-00141FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry