Mouse Anti-Chimpanzee IFNG Antibody (MO-AB-19640W)


Cat: MO-AB-19640W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO19640W
SpecificityThis antibody binds to Chimpanzee IFNG.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. Mutations in this gene are associated with an increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases.
Product OverviewMouse Anti-Chimpanzee IFNG Antibody is a mouse antibody against IFNG. It can be used for IFNG detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInterferon gamma; IFN-gamma; IFNG
UniProt IDH2Q6F3
Protein RefseqThe length of the protein is 166 amino acids long.
The sequence is show below: MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAVKTGKRKRSQMLFRGRRASQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry