Mouse Anti-Chimpanzee LSM3 Antibody (MO-AB-11348W)


Cat: MO-AB-11348W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO11348W
SpecificityThis antibody binds to Chimpanzee LSM3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionComponent of LSm protein complexes, which are involved in RNA processing and may function in a chaperone-like manner. Component of the cytoplasmic LSM1-LSM7 complex which is involved in mRNA degradation by activating the decapping step. Component of the nuclear LSM2-LSM8 complex, which is involved in splicing of nuclear mRNAs. LSM2-LSM8 associates with multiple snRNP complexes containing the U6 snRNA (U4/U6 snRNP, U4/U6.U5 snRNP, and free U6 snRNP). It binds directly to the U6 snRNA and plays a role in the biogenesis and stability of the U6 snRNP and U4/U6 snRNP complexes. It probably also is involved in degradation of nuclear pre-mRNA by targeting them for decapping. LSM3 binds specifically to the 3''-terminal U-tract of U6 snRNA. LSM2-LSM8 probably is involved in processing of pre-tRNAs, pre-rRNAs and U3 snoRNA. LSM3, probably in a complex that contains LSM2-LSM7 but not LSM1 or LSM8, associates with the precursor of the RNA component of RNase P (pre-P RNA) and may be involved in maturing pre-P RNA. LSM3 is required for processing of pre-tRNAs, pre-rRNAs and U3 snoRNA.
Product OverviewMouse Anti-Chimpanzee LSM3 Antibody is a mouse antibody against LSM3. It can be used for LSM3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLSM3 homolog, U6 small nuclear RNA associated; LSM3
UniProt IDH2QM39
Protein RefseqThe length of the protein is 102 amino acids long.
The sequence is show below: MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG.
See other products for " LSM3 "
MO-AB-15122RMouse Anti-Cattle LSM3 Antibody (MO-AB-15122R)
CBMOAB-02107CRMouse Anti-Yeast LSM3 Antibody (CBMOAB-02107CR)
MO-AB-48624WMouse Anti-Maize LSM3 Antibody (MO-AB-48624W)
MO-AB-27789WMouse Anti-Cottonwood LSM3 Antibody (MO-AB-27789W)
MO-AB-70037WMouse Anti-Silkworm LSM3 Antibody (MO-AB-70037W)
MO-AB-11988YMouse Anti-O. mykiss LSM3 Antibody (MO-AB-11988Y)
MO-AB-13901YMouse Anti-Sea-anemone LSM3 Antibody (MO-AB-13901Y)
CBMOAB-23325FYAMouse Anti-D. melanogaster Lsm3 Antibody (CBMOAB-23325FYA)
MO-AB-26857HMouse Anti-Rat Lsm3 Antibody (MO-AB-26857H)
MO-AB-58434WMouse Anti-Marmoset LSM3 Antibody (MO-AB-58434W)
For Research Use Only | Not For Clinical Use.
Online Inquiry