Mouse Anti-Chimpanzee MAP1LC3B Antibody (MO-AB-21877W)


Cat: MO-AB-21877W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO21877W
SpecificityThis antibody binds to Chimpanzee MAP1LC3B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Cytosol; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component.
Product OverviewMouse Anti-Chimpanzee MAP1LC3B Antibody is a mouse antibody against MAP1LC3B. It can be used for MAP1LC3B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMicrotubule-associated protein 1 light chain 3 beta; Microtubule-associated proteins 1A / 1B light chain 3B; MAP1LC3B
UniProt IDG2HEJ5
Protein RefseqThe length of the protein is 125 amino acids long.
The sequence is show below: MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV.
For Research Use Only | Not For Clinical Use.
Online Inquiry