Mouse Anti-Chimpanzee PDK1 Antibody (MO-AB-22683W)


Cat: MO-AB-22683W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO22683W
SpecificityThis antibody binds to Chimpanzee PDK1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPyruvate dehydrogenase (PDH) is a mitochondrial multienzyme complex that catalyzes the oxidative decarboxylation of pyruvate and is one of the major enzymes responsible for the regulation of homeostasis of carbohydrate fuels in mammals. The enzymatic activity is regulated by a phosphorylation/dephosphorylation cycle. Phosphorylation of PDH by a specific pyruvate dehydrogenase kinase (PDK) results in inactivation. Multiple alternatively spliced transcript variants have been found for this gene.
Product OverviewMouse Anti-Chimpanzee PDK1 Antibody is a mouse antibody against PDK1. It can be used for PDK1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPyruvate dehydrogenase kinase, isozyme 1; PDK1
UniProt IDH2QIZ6
Protein RefseqThe length of the protein is 436 amino acids long.
The sequence is show below: MRLARLLRGAAFAGPGPGLRAAGSSRSFSSDSGSSPASERGVPGQVDFYARFSPSPLSMKQFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSINPNCNVVEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA.
See other products for " Pdk1 "
MO-AB-34997HMouse Anti-Tomato Pdk1 Antibody (MO-AB-34997H)
CBMOAB-92082FYAMouse Anti-Zebrafish pdk1 Antibody (CBMOAB-92082FYA)
CBMOAB-08277HCBMouse Anti-C. elegans PDK1 Antibody (CBMOAB-08277HCB)
CBMOAB-27390FYAMouse Anti-D. melanogaster Pdk1 Antibody (CBMOAB-27390FYA)
MO-AB-61238WMouse Anti-Marmoset PDK1 Antibody (MO-AB-61238W)
CBMOAB-54175FYAMouse Anti-Rhesus PDK1 Antibody (CBMOAB-54175FYA)
MO-DKB-03162WRabbit Anti-PDK1 (AA 300-400) Antibody (Cat MO-DKB-03162W)
CBMOAB-38493FYCMouse Anti-Arabidopsis PDK1 Antibody (CBMOAB-38493FYC)
MO-AB-06147HMouse Anti-Frog pdk1 Antibody (MO-AB-06147H)
For Research Use Only | Not For Clinical Use.
Online Inquiry