Cat: MO-AB-09896W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Chimpanzee (Pan troglodytes) |
Clone | MO09896W |
Specificity | This antibody binds to Chimpanzee PTPRC. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein product of this gene, best known as CD45, is a member of the protein tyrosine phosphatase (PTP) family. PTPs are signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. CD45 contains an extracellular domain, a single transmembrane segment, and two tandem intracytoplasmic catalytic domains, and thus belongs to the receptor type PTP family. |
Product Overview | Mouse Anti-Chimpanzee PTPRC (clone MO09896W) Antibody (MO-AB-09896W) is a mouse antibody against PTPRC. It can be used for PTPRC detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | CD45; PTPRC |
UniProt ID | Q6QIN0 |
Protein Refseq | The length of the protein is 72 amino acids long. The sequence is show below: EKYANITVDYLYNKETKLFTAKLNVNENVECGNNTCTNNEVHNLTECKNMSVSISHNSCTAPDKTLLLDVPP. |
See other products for " PTPRC "
MO-AB-26853W | Mouse Anti-Chimpanzee PTPRC Antibody (MO-AB-26853W) |
MO-AB-03644Y | Mouse Anti-Chicken Ptprc Antibody (MO-AB-03644Y) |
CBMOAB-94615FYA | Mouse Anti-Zebrafish ptprc Antibody (CBMOAB-94615FYA) |
MO-AB-05415W | Mouse Anti-Rhesus PTPRC Antibody (MO-AB-05415W) |
MO-AB-09789W | Mouse Anti-Chimpanzee PTPRC Antibody (MO-AB-09789W) |
CBMOAB-00180FYA | Mouse Anti-Rabbit PTPRC Antibody (CBMOAB-00180FYA) |
CBMOAB-00051FYA | Mouse Anti-Cattle PTPRC Antibody (CBMOAB-00051FYA) |
MOFY-0522-FY68 | Rat Anti-PTPRC Antibody (MOFY-0522-FY68) |
MO-AB-46262W | Mouse Anti-Horse PTPRC Antibody (MO-AB-46262W) |
MO-AB-25498W | Mouse Anti-Chimpanzee PTPRC Antibody (MO-AB-25498W) |
For Research Use Only | Not For Clinical Use.