Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September, the 10th Annual Immuno-Oncology Summit in October, and the Antibody Engineering & Therapeutics (US) 2022 in December for expert consultation on your drug discovery projects. Shoot an email to arrange an in-person meeting!

Mouse Anti-Chimpanzee PTPRC Antibody (MO-AB-10235W)


Cat: MO-AB-10235W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO10235W
SpecificityThis antibody binds to Chimpanzee PTPRC.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein product of this gene, best known as CD45, is a member of the protein tyrosine phosphatase (PTP) family. PTPs are signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. CD45 contains an extracellular domain, a single transmembrane segment, and two tandem intracytoplasmic catalytic domains, and thus belongs to the receptor type PTP family.
Product OverviewMouse Anti-Chimpanzee PTPRC (clone MO10235W) Antibody (MO-AB-10235W) is a mouse antibody against PTPRC. It can be used for PTPRC detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD45; PTPRC
UniProt IDQ6QIR2
Protein RefseqThe length of the protein is 65 amino acids long.
The sequence is show below: LTTAKMPSVPLSSDPLPTHTTAFSPASTFERENDFPETTTSLSPDNTSTQVSPDSLDNASAFNTT.
For Research Use Only | Not For Clinical Use.

Online Inquiry