Mouse Anti-Chimpanzee PTPRC Antibody (MO-AB-27123W)


Cat: MO-AB-27123W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO27123W
SpecificityThis antibody binds to Chimpanzee PTPRC.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein product of this gene, best known as CD45, is a member of the protein tyrosine phosphatase (PTP) family. PTPs are signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. CD45 contains an extracellular domain, a single transmembrane segment, and two tandem intracytoplasmic catalytic domains, and thus belongs to the receptor type PTP family.
Product OverviewMouse Anti-Chimpanzee PTPRC (clone MO27123W) Antibody (MO-AB-27123W) is a mouse antibody against PTPRC. It can be used for PTPRC detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD45; PTPRC
UniProt IDQ6QIQ4
Protein RefseqThe length of the protein is 46 amino acids long.
The sequence is show below: VSSVQTPHLPTHADSQTPSAGTDTQTFSGSAANAKLNPTPGSNAIS.
For Research Use Only | Not For Clinical Use.

Online Inquiry