Mouse Anti-Chimpanzee RPIA Antibody (MO-AB-22289W)


Cat: MO-AB-22289W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO22289W
SpecificityThis antibody binds to Chimpanzee RPIA.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is an enzyme, which catalyzes the reversible conversion between ribose-5-phosphate and ribulose-5-phosphate in the pentose-phosphate pathway. This gene is highly conserved in most organisms. The enzyme plays an essential role in the carbohydrate metabolism. Mutations in this gene cause ribose 5-phosphate isomerase deficiency. A pseudogene is found on chromosome 18.
Product OverviewMouse Anti-Chimpanzee RPIA Antibody is a mouse antibody against RPIA. It can be used for RPIA detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRibose 5-phosphate isomerase A; RPIA
UniProt IDH2QIB4
Protein RefseqThe length of the protein is 311 amino acids long.
The sequence is show below: MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSGTRGGAGNTSTSCGDSSSICPAPSTMSKAEEAKKLAGRAAVENHVRNNQVLGIGSGSTIVHAVQRIAERVKQENLNLVCIPTSFQARQLILQYGLTLSDLDRHPEIDLAIDGADEVDADLNLIKGGGGCLTQEKIVAGYASRFIVIADFRKDSKNLGDQWHKGIPIEVIPMAYVPVSRAVSQKFGGVVELRMAVNKAGPVVTDNGNFILDWKFDRVHKWSEVNTAIKMIPGVVDTGLFINMAERVYFGMQDGSVNMREKPFC.
See other products for " RPIA "
CBMOAB-56745FYAMouse Anti-Rhesus RPIA Antibody (CBMOAB-56745FYA)
CBMOAB-96386FYAMouse Anti-Zebrafish rpia Antibody (CBMOAB-96386FYA)
MO-AB-28845RMouse Anti-Pig RPIA Antibody (MO-AB-28845R)
CBMOAB-2401YCMouse Anti-E. coli rpiA Antibody (CBMOAB-2401YC)
MO-DKB-00246WRabbit Anti-rpiA Antibody (MO-DKB-00246W)
MO-AB-19468RMouse Anti-Cattle RPIA Antibody (MO-AB-19468R)
MO-AB-07217HMouse Anti-Frog rpia Antibody (MO-AB-07217H)
For Research Use Only | Not For Clinical Use.
Online Inquiry