Mouse Anti-Chmp2B Antibody (CBMOAB-13497FYA)
Cat: CBMOAB-13497FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-13497FYA | Monoclonal | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Pig (Sus scrofa), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Frog (Xenopus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO13497FYA | 100 µg | ||
| CBMOAB-70399FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO70399FYA | 100 µg | ||
| MO-AB-10172R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO10172R | 100 µg | ||
| MO-AB-13670W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO13670W | 100 µg | ||
| MO-AB-24774H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24774C | 100 µg | ||
| MO-AB-52958W | Monoclonal | Marmoset | WB, ELISA | MO52958W | 100 µg | ||
| MO-DKB-01021W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Pig (Sus scrofa), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Frog (Xenopus) | WB, IF, IHC, IHC-P | 100 µg | |||
| MO-DKB-01429W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Pig (Sus scrofa), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Frog (Xenopus) | WB, IF | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Pig (Sus scrofa), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Frog (Xenopus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO13497FYA |
| Specificity | This antibody binds to fruit fly Chmp2B. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Endosome |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a component of the heteromeric ESCRT-III complex (Endosomal Sorting Complex Required for Transport III) that functions in the recycling or degradation of cell surface receptors. ESCRT-III functions in the concentration and invagination of ubiquitinated endosomal cargos into intralumenal vesicles. The protein encoded by this gene is found as a monomer in the cytosol or as an oligomer in ESCRT-III complexes on endosomal membranes. It is expressed in neurons of all major regions of the brain. Mutations in this gene result in one form of familial frontotemporal lobar degeneration. |
| Product Overview | Mouse Anti-D. melanogaster Chmp2B Antibody is a mouse antibody against Chmp2B. It can be used for Chmp2B detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Charged multivesicular body protein 2b; LD36173p; CHMP2B |
| UniProt ID | Q9VRJ5 |
| Protein Refseq | The length of the protein is 212 amino acids long. The sequence is show below: MFNNIFGKKPTVKEQQRENDRSLRKATRDIERERRKMEEEERKLELEIRRNAAAGNNDACRILAKQLVEIRKQKSRTYAAAGKIQSIGYQNKNMGANIALSEAMGTTAKTMGEMNKVMRPEAIGETVRQFQAANMKMEMTDEMINDTLDDMLNESGDEEESNAVVNKVLDEIGIEISGKMSSIPATGSSDFETSGKRTEKDIADQLAKLRSS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry