AibGenesis™ Mouse Anti-CHRDL2 Antibody (CBMOAB-39223FYA)


Cat: CBMOAB-39223FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39223FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio) WB, ELISA MO39223FYA 100 µg
CBMOAB-70436FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO70436FYA 100 µg
MO-AB-10189R Monoclonal Cattle (Bos taurus) WB, ELISA MO10189R 100 µg
MO-AB-26230W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26230W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio)
CloneMO39223FYA
SpecificityThis antibody binds to Rhesus CHRDL2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the chordin family of proteins. Chordin family members are secreted proteins that share a cysteine-rich pro-collagen repeat domain and associate with members of the transforming growth factor beta superfamily. In vitro assays demonstrate a direct interaction between the encoded protein and human activin A. This gene is expressed in many tissues including osteoblasts, where it is differentially expressed during differentiation. In addition, its expression is upregulated in human osteoarthritic joint cartilage, suggesting a role in adult cartilage regeneration. (From NCBI)
Product OverviewMouse Anti-Rhesus CHRDL2 Antibody is a mouse antibody against CHRDL2. It can be used for CHRDL2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCHRDL2
UniProt IDF7BL32
Protein RefseqThe length of the protein is 432 amino acids long.
The sequence is show below: MALVGLPGPDMFCLFHGKRYSPGESWHPYLEPQGLMYCLRCTCSESAHVSCYRLHCPPVHCPQPVTEPQQCCPRCVEPHTPSGLRAPPKSCQHNGTMYQHGEIFSAHELFPSRLPNQCVLCSCTEGQIYCGLMTCPEPGCPAPLPLPDSCCQACKDEASEQSAEEDSVQSLHGVRHPQDPCSSDAGRKRGPGTPAPTGLSAPLSFIPRHFRPKGAGSTTVKIVLKEKHKKACVHGGKTYSHGEVWHPAFRAFGPLPCILCTCEDGRQDCQRVTCPTEYPCHHPEKVAGKCCKICPEDKADPGHSEISSTRCPKAPGRVLVHTSVSPSPDNLRRFALEHEASDVVEIYLWKLVKDEETEAQRGEVPGPRPHSQDLPLDSDQESQEARLPERGTALPAARWPPRRSLERLPSPDPGAEGHGQSRQSDQDIITKT.
For Research Use Only | Not For Clinical Use.
Online Inquiry