Mouse Anti-CKM Antibody (CBMOAB-39312FYA)
Cat: CBMOAB-39312FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-39312FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Dog, Human, Mouse, Rat, Frog (Xenopus laevis), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Pig, Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO39312FYA | 100 µg | ||
MO-AB-02423H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02423C | 100 µg | ||
MO-AB-03526W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO03526W | 100 µg | ||
MO-AB-07594Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07594Y | 100 µg | ||
MO-AB-10269R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO10269R | 100 µg | ||
MO-AB-10929Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO10929Y | 100 µg | ||
MO-AB-21391W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO21391W | 100 µg | ||
MO-AB-24622R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24622R | 100 µg | ||
MO-AB-29555W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29555W | 100 µg | ||
MO-DKB-03588W | Polyclonal | Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA, IHC-P, IHC-Fr, IF, ICC | 100 µg | |||
MOFY-0722-FY164 | Polyclonal | Dog, Human, Mouse, Rat | WB, IHC, ICC, IP | 100 µg | |||
MOFY-0722-FY290 | Polyclonal | Pig, Human, Mouse, Rat | WB, IHC, ICC, IP | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Dog, Human, Mouse, Rat, Frog (Xenopus laevis), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Pig, Rabbit (Oryctolagus cuniculus) |
Clone | MO39312FYA |
Specificity | This antibody binds to Rhesus CKM. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. |
Product Overview | Mouse Anti-Rhesus CKM Antibody is a mouse antibody against CKM. It can be used for CKM detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | CKM |
UniProt ID | F6ZLQ5 |
Protein Refseq | The length of the protein is 380 amino acids long. The sequence is show below: MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLDLYKKLRDKETPSGFTLDDVIQTGVDNPGEPPCTRIPCRSQGEESWEYLPSRFPPVLSLMLRGEEERDHRRDGGREKYRDTEKKGTNACRKGRGREQQQGEPWASTPWLKWDRLPTTPSCVPIALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK. |
For Research Use Only | Not For Clinical Use.
Online Inquiry