Mouse Anti-CMA1 Antibody (CBMOAB-39455FYA)


Cat: CBMOAB-39455FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39455FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Dog (Canis lupus familiaris), Guinea pig (Cavia porcellus), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) WB, ELISA MO39455FYA 100 µg
MO-AB-07648Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07648Y 100 µg
MO-AB-09654W Monoclonal Cat (Felis catus) WB, ELISA MO09654W 100 µg
MO-AB-24902H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24902C 100 µg
MO-AB-29611W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29611W 100 µg
MO-AB-41427W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41427W 100 µg
MO-AB-53227W Monoclonal Marmoset WB, ELISA MO53227W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Dog (Canis lupus familiaris), Guinea pig (Cavia porcellus), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus)
CloneMO39455FYA
SpecificityThis antibody binds to Rhesus CMA1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a chymotryptic serine proteinase that belongs to the peptidase family S1. It is expressed in mast cells and is thought to function in the degradation of the extracellular matrix, the regulation of submucosal gland secretion, and the generation of vasoactive peptides. In the heart and blood vessels, this protein, rather than angiotensin converting enzyme, is largely responsible for converting angiotensin I to the vasoactive peptide angiotensin II. Alternative splicing results in multiple variants. (From NCBI)
Product OverviewMouse Anti-Rhesus CMA1 Antibody is a mouse antibody against CMA1. It can be used for CMA1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCMA1
UniProt IDF6XM02
Protein RefseqThe length of the protein is 136 amino acids long.
The sequence is show below: MLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRYFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRLDAKPPAVFTRISHYRPWINKILQAN.
For Research Use Only | Not For Clinical Use.
Online Inquiry