Mouse Anti-COL27A1 Antibody (CBMOAB-39646FYA)


Cat: CBMOAB-39646FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39646FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO39646FYA 100 µg
MO-AB-10513R Monoclonal Cattle (Bos taurus) WB, ELISA MO10513R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO39646FYA
SpecificityThis antibody binds to Rhesus COL27A1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCOL27A1 (Collagen Type XXVII Alpha 1 Chain) is a Protein Coding gene. Diseases associated with COL27A1 include Steel Syndrome and Cervix Uteri Carcinoma In Situ. Among its related pathways are Integrin Pathway and ERK Signaling. Gene Ontology (GO) annotations related to this gene include extracellular matrix structural constituent. An important paralog of this gene is COL24A1.
Product OverviewMouse Anti-Rhesus COL27A1 Antibody is a mouse antibody against COL27A1. It can be used for COL27A1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCollagen alpha-1(XXVII) chain preproprotein; COL27A1
UniProt IDH9FHM0
Protein RefseqThe length of the protein is 186 amino acids long.
The sequence is show below: GFKGIQGPRGPPGLMGKEGIIGPLGILGPSGLPGPKGDKGSRGDWGLQGPRGPPGPRGRPGPPGPPGGPIQLQQDDLGVAFQTWMDTSGALRPEGYSYPDRLVLDQGGEIFKTLHYLSNLIQSIKTPLGTKENPARVCRDLMDCEQKMVDGTYWVDPNLGCSSDTIEVSCNFTHGGQTCLKPITAS.
For Research Use Only | Not For Clinical Use.
Online Inquiry